KEGG   Methanolobus psychrophilus: Mpsy_0817Help
Entry
Mpsy_0817         CDS       T02280                                 

Definition
(GenBank) DNA ligase I, ATP-dependent Dnl1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy03030  DNA replication
mpy03410  Base excision repair
mpy03420  Nucleotide excision repair
mpy03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mpy00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Mpsy_0817
   03410 Base excision repair
    Mpsy_0817
   03420 Nucleotide excision repair
    Mpsy_0817
   03430 Mismatch repair
    Mpsy_0817
Enzymes [BR:mpy01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mpsy_0817
    6.5.1.6  DNA ligase (ATP or NAD+)
     Mpsy_0817
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Mpsy_0817
DNA replication proteins [BR:mpy03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Mpsy_0817
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Mpsy_0817
DNA repair and recombination proteins [BR:mpy03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Mpsy_0817
   NER (nucleotide excision repair)
    Other NER factors
     Mpsy_0817
   MMR (mismatch exicision repair)
    Other MMR factors
     Mpsy_0817
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AFV23026
UniProt: K4MLF3
LinkDB All DBs
Position
complement(807450..809174)
Genome map
AA seq 574 aa AA seqDB search
MTSFREFSQACRMIEATPGSLEMTSQVAELLKRVSPEELPIVTHFVMGEVFPAWSSQEVG
VGAGILYAALAKSSGLSVNDIEGLIRDTGDIGETAVKALAKRSKGQATFSSFLEEAPDIS
IHEVFERFHAISRSSGKGSQTSRIKNLQYLFNCATPDEVGYIARLAVEDLRIGVGEGIVR
DAIASAFNVPVATVERAFMLTNDMGLVSVTAREGGAESVEGLGLQLNRPIRMMLAQIAPT
IESAIADIGEAAIEWKFDGARVQIHKDGDRVSLYSRKLEDISGSLPDIAASIRKYVHTDS
AILDGEAVAMDERGRPRAFQDILRRLRRKHEVDSTAKEIPLSINIFDIMYLNGEGLIDAP
LVKRREMLEGCVENGDSIRVDRQVVTSDPEEINIIYTEALRAGHEGIMIKNPQSPYSPGK
RGKNWLKKKPVMETLDLAVIGAEWGYGRRTSFMGSYALACHDPKTGRFLPVGKVATGFSD
EQLSELTAVFSDLIVMQSGTKIELKPQVIFEVAFEEIQKSTNYESGYALRFPRLVNVRDD
KSLEDVETIGRLEEMYRLQRERGINPGNAEVGGK
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgacaagtttcagggaattttcacaggcctgcaggatgatagaggcgaccccggggtcc
ctggagatgacttcccaggttgcagagctgctaaaaagagtaagtccggaagaacttccc
attgtcactcattttgtcatgggtgaagtattccctgcctggagctctcaggaagtgggg
gtgggagcgggtatcctctatgctgctcttgcaaagtcttccgggctctccgtgaatgac
atagaaggtctcataagggacacaggcgacataggtgaaactgctgtaaaggcactcgcc
aaaaggtcaaagggtcaggcgacgttctcctcattcctggaggaagcgcctgatatttcc
atacatgaagtgttcgaacgtttccatgccatctcaaggtcatcaggcaaaggttcccag
acttccaggataaagaatcttcagtaccttttcaactgcgcaacccctgatgaggttggt
tatatagccagacttgccgtagaggacctgagaataggtgtcggtgagggaatcgtgcgt
gatgccatagcatctgctttcaatgttcctgtggctactgtagagcgggctttcatgctt
accaatgacatgggccttgtgtcagtcactgcaagggaaggtggagcagagtcagtggaa
ggacttggcctgcagttgaaccgcccaataagaatgatgcttgcgcagatagctcccact
atcgaatcagctatcgcggatattggcgaggcagctatcgagtggaagtttgacggtgca
agggtgcagatccataaagatggggaccgggtgtcattatactcccgcaagcttgaggac
ataagcggctctttgcctgatattgctgcgtcgataaggaaatatgttcacacggattca
gccatacttgacggtgaagctgtcgcaatggatgagaggggtcgcccaagagctttccag
gacatactgaggcgcctgaggcgtaagcacgaagtagattctactgctaaggaaattccg
ctgtcgatcaatatttttgatataatgtatcttaatggagagggccttatagatgctccc
ttggtaaaaagaagggaaatgcttgagggctgcgttgagaatggtgattccatccgtgtg
gaccggcaggttgtaaccagcgaccccgaagagatcaatatcatctacacagaggctctc
agggcaggtcatgaaggcatcatgatcaagaacccccagtctccttattcacctggaaaa
cgcgggaagaactggcttaaaaagaagcctgtcatggaaacactcgaccttgccgtgata
ggcgccgaatggggctatggcagacgtaccagtttcatgggttcgtatgctcttgcatgc
catgatcccaagacaggacgtttcctgcctgtcggaaaagtagctacaggtttttccgac
gagcagctatctgaactgacagcagtcttctcggacctgatagttatgcaatccggtaca
aagatagagctcaaaccccaggttatattcgaggttgcattcgaagagatacagaagagc
accaattatgagtccggctatgctctcaggtttccccggctcgtgaacgtgagggatgac
aaatcgctagaagatgttgagaccattggcaggcttgaggaaatgtaccgcctgcagagg
gaaaggggaattaaccccggtaatgcagaagtaggtggcaaatga

DBGET integrated database retrieval system