KEGG   Methanolobus psychrophilus: Mpsy_1724
Entry
Mpsy_1724         CDS       T02280                                 

Definition
(GenBank) hypothetical protein
  KO
K16182  3-methylornithyl-N6-L-lysine dehydrogenase [EC:1.4.1.-]
Organism
mpy  Methanolobus psychrophilus
Pathway
mpy00300  Lysine biosynthesis
mpy01100  Metabolic pathways
mpy01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpy00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mpsy_1724
Enzymes [BR:mpy01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.-  
     Mpsy_1724
SSDB
Motif
Pfam: NAD_binding_7 2-Hacid_dh_C 3HCDH_N NAD_binding_2 ApbA TrkA_N adh_short F420_oxidored AlaDh_PNT_C UDPG_MGDP_dh_N IlvN Shikimate_DH
Other DBs
NCBI-ProteinID: AFV23931
LinkDB
Position
1692587..1693366
AA seq 259 aa
MALLTSRDLENLSMQLEENDETIKRVTGLDVRGICEELYGTKPGSLKVGIIPITAGDGII
SNFASSLLFITQYFGLEGAITEHSDMTGYYEAVSQGADIILMADDHMFVAHNLRKGKIVS
NHVATGIIYAEIASRFREASSKDILVIGLGRVGYAGAAHLMKKGFNVYACDPNRGFLEKA
VKELGIKPYCSEDRKRFSMVLEATPNANTISEGMIEERCLVSTPGIPCGLPPEIGKKYRV
DLVMEPLVIGVASMLYSVI
NT seq 780 nt   +upstreamnt  +downstreamnt
atggcgcttctgacatcccgggaccttgagaacctgtcaatgcagcttgaagagaacgat
gagactataaaaagggttacagggcttgatgttcggggaatatgcgaagaactgtacggc
acaaaacccggctctctgaaggtcggtattatccctataactgcaggtgacggcatcatc
agtaattttgcatcttccctgctatttattactcaatacttcggacttgagggagccatt
accgaacactctgatatgaccggctattatgaggcagtctcgcagggtgccgatataata
ctgatggcagatgaccatatgttcgttgcacataacctgcgcaaggggaagatagtcagc
aaccacgttgctacaggaattatatatgctgagatagcttccagattcagggaagcatcc
tcaaaagatatccttgtgataggccttggaagggtgggttatgcaggtgctgcacatctt
atgaaaaaagggttcaatgtctatgcatgtgaccctaacaggggatttctggagaaagct
gtgaaagagctgggaattaagccttactgcagtgaggacaggaaaaggttctccatggtc
cttgaagccacccccaatgcaaatactatatctgaaggcatgatcgaggaaagatgcctg
gtgtcgactcccggcataccatgtggcctgcctccggagataggtaagaaatatcgtgtc
gacctcgtcatggaacccctggtcattggggtcgcatctatgctgtattccgttatctga

DBGET integrated database retrieval system