KEGG   Marinitoga piezophila: Marpi_0130Help
Entry
Marpi_0130        CDS       T01665                                 

Definition
(GenBank) alpha-glucan phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
mpz  Marinitoga piezophila
Pathway
mpz00500  Starch and sucrose metabolism
mpz01100  Metabolic pathways
mpz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Marpi_0130
Enzymes [BR:mpz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Marpi_0130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase DUF3417 DUF5010
Motif
Other DBs
NCBI-ProteinID: AEX84587
UniProt: H2J369
LinkDB All DBs
Position
126921..129488
Genome map
AA seq 855 aa AA seqDB search
MEFISRINVLPKVPENLKKLPELSRNLWWTWNYDAQEIFERIDEDLWVEVNRNPVAFLKK
VSQKKLNEAAQNQAILSLYSQVVEKFENYMKAENTWFKSTHKQYKGGEFAYFCAEYGLHE
SFPNYSGGLGVLAGDHLKSASDLGIPLVAVGLLYKQGYFEQRINSEGWQEAIFNPYDFDN
FPVVPVKDDEGNEIYITVEMDNRKVYAKIWKLSVGRINLIYLDTDIPQNDPEDRMITYQL
YGGDQEMRIRQEMLLGIGGVRALRTLGYNPSVWHMNEGHSAFLGLERIREFVQEHGLTFR
EAVQAAKAGAVFTTHTPVPAGHDAFPFHLMDKYFKDYWPQLKASRREFLDLGAEIRADGS
ELFSMTTLALNLSSRANGVSKLHGEVSRDLAKDIWKGLEAVEVPITHVTNGVHATTWISK
ELQDLFAHYLGKDWHEKIDDPDLWKKIDEIPDEELWNVRKSLKKKLIEFVHQRTKEQRMR
HGETVEQLEEIENILNPKALTIGFARRFATYKRATLIFKDLERLSKILNNPERPVQLIFA
GKAHPADRPGQELIKRIYEISRMPEFKDKIVFIENYDMNVARHLVAGVDVWLNNPRRPRE
ASGTSGQKAGMNGSPNFSVLDGWWVEGYNGKNGWAIGDERDYTDLELQDRIDSSSMYNTL
EKEIVPLYYDHNEELGVSREWIKIMKESIKSVTSFFNTHRMLKEYTQKLYMTAAELGEKF
VKDNFEIAKKFSAWVEILEKNWGNIRIKVLSNVTEDIEYSTGGKIEVKAEVYLPGIGPDS
VLTQIVVAKLEDNKIVTLKSFDMKLKKEVNKDTYLYEGEFEIDERGQYGWNVRVIPYNPI
MPYQHYLIGFVKYPQ
NT seq 2568 nt NT seq  +upstreamnt  +downstreamnt
atggaatttatttcaaggataaatgtattaccaaaagtgcctgaaaatttaaaaaaatta
ccagaattaagtagaaatctctggtggacctggaattatgatgcacaggagatttttgaa
agaattgatgaagatttatgggttgaagtaaatagaaatcctgttgcatttttaaaaaag
gtaagccagaaaaaattgaacgaggcagcgcaaaatcaggctatattgagtttatactct
caggtagtggaaaaatttgaaaattatatgaaagctgaaaatacatggtttaaatccaca
cataaacaatataaaggtggagaatttgcatatttttgtgctgaatatggattacatgaa
tcatttccaaattattctggaggattaggtgtattagctggtgatcatttaaaatcagca
agtgatttgggaattccattggttgctgttggacttttgtataaacagggatactttgaa
caaaggattaattctgaaggctggcaggaagctatttttaatccttatgattttgataat
tttcctgtagttccagtaaaagatgatgaaggaaatgaaatttatataacagtagaaatg
gataatagaaaagtttatgcgaagatatggaaattatccgttggaagaataaatttaatt
tatcttgatacagatattccgcaaaatgatcctgaagatagaatgattacctaccaatta
tatggcggggatcaggaaatgcgaataaggcaggaaatgcttttgggtattggaggagtt
agagcattaagaactcttggatataacccatcggtatggcatatgaatgaaggtcattct
gcatttttaggtttagaaagaattagagaatttgttcaggaacacggtttaacatttaga
gaagcagttcaagcagcaaaagctggtgcggtatttacaacacatactcctgttccagca
ggtcatgatgcatttccttttcatttaatggataaatatttcaaagattattggccacaa
cttaaagcatcaagaagggaatttcttgacttaggagctgaaataagggctgatggttct
gaattattttcaatgacaacattagctttaaatttatcctcaagagcaaacggagtaagt
aaattacatggtgaagtatcacgggatttagcaaaagacatatggaaaggacttgaagca
gttgaggttccaattacacatgtaacaaatggtgttcatgcaacaacatggatttccaaa
gaattacaggatttatttgctcattatcttggaaaagactggcatgaaaagattgatgat
cctgatttatggaaaaaaattgatgagattccagatgaagaattatggaatgtaagaaaa
tctttaaagaaaaaattaattgaatttgtacatcaaagaactaaagaacaaagaatgaga
catggtgaaacagtagaacaacttgaagaaatagaaaatattcttaatccaaaggcttta
acaataggttttgcaagaagatttgcaacatataaaagagctacattaatttttaaagac
cttgaaaggctcagtaaaattttaaataatccagaaagacctgttcaattgatttttgcg
ggtaaagcacatccggcagatagaccaggtcaggaattaataaaaagaatttacgaaatt
tcaagaatgcctgaatttaaagataaaatagtatttattgaaaattatgatatgaatgtt
gcaaggcatttagtagccggtgttgatgtatggcttaataatccacgaagaccaagagaa
gcaagtggaacaagtggtcaaaaagctggtatgaacggttctccgaactttagtgttctt
gatggttggtgggttgaaggttataatggaaaaaatggatgggctataggtgatgaaaga
gattacacagaccttgaattacaggatagaatagatagttcatcaatgtataatactctt
gaaaaagaaattgtacctctttattatgaccataatgaagaattgggagtttcaagagaa
tggataaaaataatgaaagaatctataaaatcagttacatcattctttaatacacataga
atgctcaaagaatatacacaaaaattatatatgactgcagcggaattaggagaaaagttt
gtaaaagataattttgaaatagctaagaaattctctgcttgggtagaaatattggagaaa
aactggggaaatattagaataaaagttctttcaaatgtaactgaagacattgaatattca
actggtggaaaaatagaagtaaaagcagaagtttatttaccgggaattgggccggattct
gtacttacacaaattgttgtagcaaaattggaagacaacaaaatagttacattaaaatcg
tttgatatgaagttgaaaaaagaagtaaataaagatacatatttgtatgaaggtgaattt
gaaatagatgaaagagggcagtatggctggaatgtaagagttattccatataatcctata
atgccatatcaacattatttaataggttttgtaaaatatccacaataa

DBGET integrated database retrieval system