KEGG   Mycobacterium tuberculosis H37Ra: MRA_3473Help
Entry
MRA_3473          CDS       T00540                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00250  Alanine, aspartate and glutamate metabolism
mra00410  beta-Alanine metabolism
mra00430  Taurine and hypotaurine metabolism
mra00650  Butanoate metabolism
mra01100  Metabolic pathways
mra01110  Biosynthesis of secondary metabolites
mra01120  Microbial metabolism in diverse environments
mra02024  Quorum sensing
Module
mra_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mra00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MRA_3473 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MRA_3473 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MRA_3473 (gadB)
   00430 Taurine and hypotaurine metabolism
    MRA_3473 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MRA_3473 (gadB)
Enzymes [BR:mra01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MRA_3473 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: ABQ75258
UniProt: A5U8A8
LinkDB All DBs
Position
complement(3859050..3860432)
Genome map
AA seq 460 aa AA seqDB search
MSRSHPSVPAHSIAPAYTGRMFTAPVPALRMPDESMDPEAAYRFIHDELMLDGSSRLNLA
TFVTTWMDPEAEKLMAETFDKNMIDKDEYPATAAIEARCVSMVADLFHAEGLRDHDPTSA
TGVSTIGSSEAVMLGGLALKWRWRQRVGSWKGRMPNLVMGSNVQVVWEKFCRYFDVEPRY
LPMERGRYVITPEQVLAAVDENTIGVVAILGTTYTGELEPIAEICAALDKLAAGGGVDVP
VHVDAASGGFVVPFLHPDLVWDFRLPRVVSINVSGHKYGLTYPGVGFVVWRGPEHLPEDL
VFRVNYLGGDMPTFTLNFSRPGNQVVGQYYNFLRLGRDGYTKVMQALSHTARWLGDQLRE
VDHCEVISDGSAIPVVSFRLAGDRGYTEFDVSHELRTFGWQVPAYTMPDNATDVAVLRIV
VREGLSADLARALHDDAVTALAALDKVKPGGHFDAQHFAH
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
gtgtctcgcagtcacccgtccgtgcccgcgcattcgatcgctccggcctacaccggtcgg
atgttcaccgcaccggtgccggcgctgcggatgcccgatgagtcgatggatcccgaggcg
gcctatcgcttcatccacgacgagctgatgctcgacggtagctcgcggctgaatctggcc
accttcgtgaccacctggatggacccggaggccgaaaagctgatggccgagacgttcgac
aagaacatgatcgataaggacgaatacccggcgaccgcggccatcgaggcgcgctgtgtg
tccatggtcgccgacctgtttcacgccgagggtctgcgcgaccacgaccccaccagcgcc
accggggtgtccaccatcggctccagcgaggcggtgatgctgggtgggctggccctgaaa
tggcgttggcggcaacgggtggggtcttggaaggggcgcatgcccaatctggtgatgggt
tcgaacgtccaggtggtgtgggagaagttctgccgctacttcgacgtcgaaccccgttac
ctgccgatggagcggggccgctacgtcatcacccccgagcaggtgctcgccgccgtcgac
gagaacaccatcggcgtggtggcgatcttgggcaccacctataccggtgaactcgaaccc
atcgccgagatctgcgccgcgctggacaaactggcggctggcgggggtgtggacgtcccg
gtacacgtcgacgcggccagtgggggctttgtggtgccgtttttgcatccggacctggta
tgggattttcggctgccccgcgtggtgtcgatcaacgtcagcggccacaagtatgggctg
acctatcccggcgtcgggtttgtcgtgtggcgcgggcccgagcacctgccggaggatctg
gttttccgggtcaactacctcggcggcgacatgccgaccttcaccctgaacttctcccgt
cccggtaaccaggtggtgggccagtactacaacttcctgcggctggggcgcgacggctat
accaaggtgatgcaggcgctgtcgcacaccgcccggtggctgggtgaccagctgcgcgag
gtggatcattgcgaggtgatctcggatggttcggcgatcccggtggtcagcttccggctc
gccggcgaccgcgggtacacggagttcgacgtctcccatgagctgcggaccttcgggtgg
caggtgcccgcctacaccatgccggacaacgccaccgacgtggcggtgctgcggatcgtg
gttcgggaaggactctccgccgacctggcgcgggccctgcacgacgacgcggtcaccgcg
ttggctgccctggacaaggtcaagccgggtggccacttcgacgcacagcatttcgcgcac
tag

DBGET integrated database retrieval system