KEGG   Mycobacterium tuberculosis H37Ra: MRA_3749Help
Entry
MRA_3749          CDS       T00540                                 

Definition
(GenBank) putative ligase
  KO
K23393  lipid II isoglutaminyl synthase (glutamine-hydrolysing) [EC:6.3.5.13]
Organism
mra  Mycobacterium tuberculosis H37Ra
Pathway
mra00550  Peptidoglycan biosynthesis
mra01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mra00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MRA_3749
Enzymes [BR:mra01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.13  lipid II isoglutaminyl synthase (glutamine-hydrolysing)
     MRA_3749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1727 Mur_ligase_M
Motif
Other DBs
NCBI-ProteinID: ABQ75538
UniProt: A5U938
LinkDB All DBs
Position
4165427..4166668
Genome map
AA seq 413 aa AA seqDB search
MVTTRARLALAAGAGARWASRVTGRGAGAMIGGLVAMTLDRSILRQLGMGRRTVVVTGTN
GKSTTTRMTAAALGTLGAVATNAEGANMDAGLVAALAAHRDAELAVLEVDEMHVPHISDA
VDPAVVVLLNLSRDQLDRVGEINVIERTLRAGLARHPDAVVVANCDDVLMTSAAYDSPNV
VWVAAGGAWSNDSVSCPRSGEVIVRKAPSQEDHWYSTGADFKRPAPHWWFDDATLYGPDG
LALPMRLALPGSVNRGNAAQAVAAAVALGADPAVAVAAVCQVDEVAGRYRTVRIGAHQAR
ILLAKNPAGWQEALAMVDKHADGVVIAVNGRVPDGEDLSWLWDVRFEHFEKTRVVAAGER
GTDLAVRLGYAGVEHTLVHDTVAAIASCPPGRVEVVANYTAFLQLQRALARRG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
gtggtaaccacccgggcacgcctggccctagccgccggcgcgggcgcacgctgggcgtcg
cgggtcaccggtcgcggcgccggagcgatgatcggcggtctggtcgccatgaccctggac
cgctcgatcctgcgccaactcgggatgggccggcgcaccgtcgtcgtcaccggcaccaac
ggcaagtcgaccaccacacggatgaccgcggccgcgctgggcacgttgggagccgtggcc
accaacgccgagggcgccaacatggacgccggcctggtggccgcgctcgccgctcaccgc
gacgccgagctggcggtgctggaagtcgacgagatgcacgtaccgcacatctccgatgcc
gtcgatcccgccgtcgtcgtcttgctcaacctctcccgagaccagctggaccgggtcggc
gagatcaacgtcatcgaacgcacactgcgggccgggctggcccggcaccccgacgctgtc
gtggtcgccaactgcgacgacgtgctgatgacctcggccgcctacgacagccccaacgtc
gtttgggtggctgccggcggcgcgtggtcaaacgattcggtcagctgcccgcgcagcggc
gaggtcatcgttcgcaaggccccctctcaggaagaccactggtactccaccggcgccgac
ttcaagcggcccgccccgcactggtggttcgacgacgccacgctgtatgggcccgacggg
ctggcgctgccgatgcggctggcactgccaggctcggtgaatcgcggcaacgccgcccaa
gccgtggccgccgcagtcgccctcggcgccgatccggctgtggccgtcgccgccgtctgc
caggtcgacgaggtcgccggacgctaccggaccgttcgtatcggcgcgcaccaagcccgg
atcctgctggccaaaaacccggccggctggcaggaagcgctggcgatggtcgacaagcat
gcagacggggtggtcatcgcggtcaacgggcgggttcctgacggcgaggacctgtcctgg
ttgtgggacgtgcgcttcgagcacttcgagaagacccgagtggtagccgctggggagcgc
ggcaccgatttggcggttcgcctcggatatgcaggcgtcgagcacaccctggtgcacgac
accgtggccgccatcgcctcatgcccacccgggcgggtggaggtcgtcgccaactacacc
gcgttcctgcagctgcaacgagcattggcgcgtcgtggctga

DBGET integrated database retrieval system