KEGG   Meiothermus ruber DSM 1279: Mrub_0994Help
Entry
Mrub_0994         CDS       T01193                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00620  Pyruvate metabolism
mrb00680  Methane metabolism
mrb00710  Carbon fixation in photosynthetic organisms
mrb01100  Metabolic pathways
mrb01120  Microbial metabolism in diverse environments
mrb01200  Carbon metabolism
Module
mrb_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mrub_0994
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mrub_0994
   00680 Methane metabolism
    Mrub_0994
Enzymes [BR:mrb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mrub_0994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ADD27759
UniProt: D3PQM6
LinkDB All DBs
Position
complement(985211..987889)
Genome map
AA seq 892 aa AA seqDB search
MNEERLFEQLKREVDVLGRALGKAIRTLSGPRIFELEEQVRELTKSLRQGYSLEARQQLL
EIVRGLSLSEAENMVRAFSTYFHLVNLAEERHRVRVNREREKNSTPGAPRGESFLALVGA
LKQQGLSYDQTVDLLSRLRLHLTFTAHPTETRRRTQRHHINEIEKLLDSLYLDDLTAAAD
SSVLDARVALLWGTSELRKSRPSVEDEVKGGLFYITYTLWKAVPRLVDGLERAVEAHYGR
RPNLSPPLVFRSWIGGDRDGNPNVLPEVTGWAQAYARETALRRFVEDVDSLIRDLSLSDE
RVTITHELRLALEDHAKRLALPERFQGEPYRQFGMGLRYKLRALLGEQPGPGYNNTAEFV
SDLGKAERSLEQLGLGAIARACLKPIRLNAEAFGLDLVSLDLREESRALTEAAAELLKIG
GVHEQYAALPPQQREALLTRELATARPLAPVGYRPQSKSLQTALEALRQWKARGAHVVSM
THYPSDLLEVMLLAREVGLYRPGRALPFDVVPLFETLGDLQNAPEVVARLLDNPVFRAHV
QGRGGLEVMIGYSDSNKDAGFLAANWALYQAQEAITKVARERGVPVYYFHGRGTSTARGG
GTAGRAIASLPPGTVGSRMRLTEQGEALADRYAHPELAYRNLEQMLYHMALASARDLYGQ
AEPPKPEWLEAMERAAERSTQVYRELLLRPGFFEFYEQLTPIREIGALNIASRPVYRSGR
VREIKDLRAIPWVMSWTQVRLLLPGWYGLAEGLQEIPLALRQEMFQQWPFFATTLDSAAI
ALAKADLGIAREYLRLVKPELAERFFPDIARSFEQTKTILEETFQSTLLFKHPVLARQTE
LRNPYVDPISLVQVELLERYRRTPPEAPERTGLERALMLSLLGIAAGLRNAG
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaggaacggctgttcgaacagctcaaacgcgaagtagacgtgctgggtcgggct
ctgggaaaggccatccgcacactttccgggccgcgcatcttcgaactggaagaacaggtg
cgcgagctgaccaaaagcctgcggcagggctactccctcgaggcccggcagcagctcctc
gagatcgtgcggggtctctcgctgtccgaggctgagaacatggtccgggccttttcgacc
tactttcacctggtcaacctggccgaggagcgccaccgcgtgcgggtcaatcgggaacgt
gagaaaaacagcaccccgggggcccccaggggggagtcgtttctggccctggtcggcgcg
ctcaaacagcaggggctgagctatgaccagaccgtcgatctgctctcccggctgcggctg
catctgacctttaccgcccaccccaccgagacccgccgccgcacccagcgccaccacatc
aacgagatcgagaagctgctggacagcctctacctcgacgacttgaccgcggctgcggat
agctcggtccttgatgcgcgggtggccctgctgtggggcacctctgagctgcgcaagtcc
cgcccgagcgtggaggacgaggtgaagggggggcttttttatatcacctacaccctctgg
aaggcggttccccggctggtggatgggctcgagcgggccgttgaggcccattatggccgg
cggcccaacctctcgcccccgctggtgtttcgtagctggattgggggcgaccgggatggc
aaccccaacgtgctgcccgaggtgacaggctgggcccaggcctacgcccgcgaaaccgcc
ctgcgcaggtttgtggaggacgtggacagcctgatccgggatctatccctcagcgacgaa
cgggtcaccatcacccacgagctgcggctggccctggaggatcacgccaagcgcctggcc
ttgcccgagcggtttcaaggcgagccctaccggcagtttggcatgggtctgcgctacaag
ctgcgggcgctgctgggcgagcagccgggccccggctacaacaacaccgcggagtttgtg
agcgaccttggcaaagccgagcgcagcctggagcagcttggtttgggggcgatcgctcga
gcctgcctgaagcccatccgcctcaacgccgaggccttcggcctggatctggtgagcctg
gatctgcgcgaggagtcgcgcgcgctgaccgaggccgccgccgagctgctcaaaatcggc
ggtgtgcacgagcagtacgccgcgctgcctccccagcaaagggaggccttgctaacccgg
gagctggccacggcccggcccctggccccggtgggctaccggccccagagcaaaagcctg
caaaccgccctcgaggccctgcgccagtggaaggcccgtggggcgcatgtggtctcgatg
acccattaccccagcgacctgctcgaggtgatgctgctggcgcgggaggtggggctctac
cgccccgggcgggccctgcccttcgatgtggtgccgctctttgaaaccctgggcgacctg
caaaacgcccccgaggtggtggcacggctgctggacaacccggtcttccgggcccacgtg
caggggcgggggggcctcgaggtcatgatcggctactccgactccaacaaggacgcgggc
ttcctggcggccaactgggcgctgtatcaggcccaggaggccatcaccaaagtcgccagg
gagcgcggcgtgccggtctactactttcacgggcggggcacttccaccgcccgcggcggg
ggcaccgcggggcgggccatcgccagcctgccacccggcacggtgggcagccggatgcgc
ctgaccgagcagggcgaggccctggccgaccgctacgcccaccccgagctggcctaccgc
aacctcgagcagatgctttaccacatggccctggcctcggcccgcgacctgtacgggcag
gccgagccgcccaaacccgagtggctcgaggccatggaacgggccgccgaacgctccacc
caggtctaccgggagctgctgctgcgcccgggcttcttcgagttttacgaacagctcacc
cccatccgcgagattggggcgctcaacatcgccagccgcccggtctaccgctcggggcgg
gtgcgcgagatcaaggatttgcgggccatcccatgggtgatgtcctggacgcaggttcgc
ttgctgctgcccggctggtacgggctggccgaaggattacaggaaattccgctggcgctg
cgccaggagatgtttcagcagtggcccttttttgccaccaccctggacagcgccgccatc
gcattggccaaagccgacctgggcatcgcccgcgagtacctgcggctggtcaagcccgag
ctggccgaacgtttcttccccgatatcgcccgctcgttcgagcagaccaaaaccatcctg
gaggaaacttttcagagcaccctgctcttcaagcaccccgtgctggcccgccagaccgag
ttgcgcaacccctacgtagaccccatctcgctggtgcaggtcgagcttctggagcgctac
cggcgcaccccgcccgaggcccccgagcgcaccggcctcgagcgggccctgatgctctcc
ttgctgggcatcgccgccggcctgcgcaacgcaggctag

DBGET integrated database retrieval system