KEGG   Meiothermus ruber DSM 1279: Mrub_2322Help
Entry
Mrub_2322         CDS       T01193                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00010  Glycolysis / Gluconeogenesis
mrb00020  Citrate cycle (TCA cycle)
mrb00620  Pyruvate metabolism
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01120  Microbial metabolism in diverse environments
mrb01130  Biosynthesis of antibiotics
mrb01200  Carbon metabolism
Module
mrb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrub_2322
   00020 Citrate cycle (TCA cycle)
    Mrub_2322
   00620 Pyruvate metabolism
    Mrub_2322
Enzymes [BR:mrb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Mrub_2322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding HlyD_3 DUF896
Motif
Other DBs
NCBI-ProteinID: ADD29073
UniProt: D3PLI2
LinkDB All DBs
Position
2371690..2373090
Genome map
AA seq 466 aa AA seqDB search
MPKEVVLPELAESVVEGEILRWLVNEGDALKKDQPFVEVMTDKVTVELPSPYEGVLLQKL
VKEGQVVPVHAPIALIAEPGEVSAVVSDKKPAPAPSLQAQEERSIVEPGQVAEDDGASLS
LFKPDNKPEQVKNPFTKAAPLASGPSAATVQAHGRVIAVPAARKLARELGLDIAQIPGSG
PNGRVRVEDVKAYAEQKSRATPPVAAPSASERGAPLLGLAPVQYKTPKGYEELETRVPLR
GLRRAIAQQMMASHLYTVRTLSVDEVDMTELVALRNRLKLEAEAQGVRLSYLPFIFKAVA
VALKKFPALNSSLDEARQEVVLKHYVNIGMAVAAENGLIVPVVRDVERKSLLQIAREINE
LAEKARSGKLTPEEVSGSTFSITNIGSIGALFSFPIINVPDAAILGVHSIQKRPVVGERD
EIVVRQMMYLSLSFDHRLVDGAEAARFTKEVIRLLEKPERLFLEAL
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgcctaaagaagtggtgctgcccgagctggcagagtcggtggtggaaggtgaaattctg
cggtggctggtgaatgaaggcgatgccttgaaaaaagaccagccttttgtggaggtcatg
accgacaaggtcacggtggagctaccgagtccctacgaaggggtgctgctgcaaaagctg
gtcaaggaggggcaggtggtgccggtgcacgcccccatcgccctgattgccgagcctggg
gaggtaagcgcggtggttagcgataaaaagcccgccccggcgcccagcctgcaagcccag
gaagagcgctccattgtggagccgggccaggtggcagaagacgacggggccagcctctcg
ttgttcaaaccggataacaagccagagcaggtcaaaaaccccttcaccaaagccgcgccg
ctggcatcggggccaagcgctgccacggttcaggcccacggacgggtgatcgcggtgccg
gcggcccgcaagctggcccgcgagctggggctggacatcgcccagataccgggttcgggg
cccaacgggcgggtgcgggtggaggacgtgaaggcctacgccgagcaaaaaagccgtgcc
acaccgcccgttgccgcaccttcggcatccgagcgcggtgcgcccctgctgggcctggcg
ccggtgcagtacaagacccccaagggctacgaggagctcgagacccgcgtacccctgcgc
ggcctgcgccgggccatcgcccagcagatgatggcctcgcacctttacacggtgcgcacc
ctctcggtggacgaggtggacatgaccgagctggtggccctgcgcaaccggctcaagctc
gaggccgaagcccagggggtcaggctcagctacctgcccttcattttcaaggcggtggcg
gtggcgctcaaaaaattcccggccctcaacagctcgctggacgaggcaaggcaggaggtg
gtgctcaagcactacgttaatatcggcatggccgtggccgccgaaaatggcctgattgtg
ccggtggtgcgggacgtggagcgcaaaagcctgctgcagattgcccgcgagattaacgag
ctggccgagaaagcccgcagcggcaagctgaccccggaggaggtaagcggctccaccttc
agcatcaccaacatcggctcgattggggcgctgttcagtttccccatcatcaacgtgccg
gacgctgccatcctgggtgtgcactccatccagaagcgcccggtggttggcgagcgcgac
gaaattgtggtgcggcagatgatgtacctctcgctctccttcgaccatcggctggtagac
ggggccgaggcggcccgcttcaccaaagaggtcatccggctcctggagaaacccgaacgg
ctcttcctggaagccctgtag

DBGET integrated database retrieval system