KEGG   Meiothermus ruber DSM 1279: Mrub_2723Help
Entry
Mrub_2723         CDS       T01193                                 

Definition
(GenBank) N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K05829  LysW-gamma-L-alpha-aminoadipyl-6-phosphate/LysW-L-glutamyl-5-phosphate reductase [EC:1.2.1.-]
Organism
mrb  Meiothermus ruber DSM 1279
Pathway
mrb00220  Arginine biosynthesis
mrb00300  Lysine biosynthesis
mrb01100  Metabolic pathways
mrb01110  Biosynthesis of secondary metabolites
mrb01210  2-Oxocarboxylic acid metabolism
mrb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mrb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Mrub_2723
   00220 Arginine biosynthesis
    Mrub_2723
Enzymes [BR:mrb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Mrub_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC
Motif
Other DBs
NCBI-ProteinID: ADD29471
UniProt: D3PNS6
LinkDB All DBs
Position
complement(2760255..2761295)
Genome map
AA seq 346 aa AA seqDB search
MSEKKTVSIVGGSGYAGGEFLRLALGHPYLEVKQVTSRRMMGDPVTLVHPNLRGRTNLKF
VDPASLEPCDILVLSMPHGVAAKEFEKYQHLAPVIVDLSADFRLKNLDLYRKYYGEDHPR
PDLVGQWVYGNPELYREALKTANYIACCGCNATATILGLYPLLQEGLLAPGPIFATVMIS
TSAAGAEPSLASHHPERAGSIRAYKPTGHRHTAEIRENLPGQPELHLTAIATDRVRGILM
TAQTFLRQGLSEKEVWGAYRKVYGAEPFIRLVKLKKGIHRYPDPNVVEGTNYCDVGFELE
EDTGRLVVISAIDNLVKGTAGHAIQSLNVRMGWPETAGLEFSGLHP
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagaaaaagacggtttcgattgtggggggttccggctacgccgggggggagttt
ctgcggctggccctggggcacccgtacctcgaggtcaaacaggtcacctcgcgccgtatg
atgggcgacccggtcacgctggtgcaccccaacctgcggggccgcaccaacctgaagttt
gtagacccggccagcctcgagccctgcgatattctggtgctttccatgccgcacggggtg
gcggccaaggagtttgagaaataccagcacctggcccccgtgatcgtggatctgtcggcg
gactttcgcctgaagaacctggatctgtacaggaaatactacggcgaagaccacccccgc
cccgaccttgtgggccagtgggtctacggcaaccccgagctgtaccgcgaggccctcaaa
accgccaactacatcgcctgctgcggctgcaacgccaccgccaccatcctgggcctctac
cccttgctgcaagagggcctgctggccccggggcccatcttcgccacggtgatgatctct
accagcgccgccggggccgagcccagcctggcctcgcaccaccccgaacgcgcgggcagc
atccgggcctacaagcccaccggccaccgccacaccgccgaaattcgcgagaacctgccg
ggccagcccgaactccacctgaccgccatcgccaccgaccgggtgcgcggcatcctgatg
accgcccagacctttttgcgccagggcctgagcgaaaaagaggtctggggggcctaccgc
aaggtgtatggggcggagcctttcatccgcctggtgaagcttaagaagggcatccaccgc
taccccgaccccaacgtggtggagggcaccaactactgcgatgtgggcttcgagctggaa
gaggataccgggcggctggtggtgatctcggccattgacaacctggtcaagggaaccgcg
ggccacgccatccagagcctgaacgtgcggatgggctggcccgagaccgcgggcctcgag
ttcagcgggctgcatccgtag

DBGET integrated database retrieval system