KEGG   Methylobacterium radiotolerans: Mrad2831_0149Help
Entry
Mrad2831_0149     CDS       T00674                                 

Definition
(GenBank) Aldehyde Dehydrogenase
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00010  Glycolysis / Gluconeogenesis
mrd00620  Pyruvate metabolism
mrd01100  Metabolic pathways
mrd01110  Biosynthesis of secondary metabolites
mrd01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mrad2831_0149
   00620 Pyruvate metabolism
    Mrad2831_0149
Enzymes [BR:mrd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     Mrad2831_0149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh YCII
Motif
Other DBs
NCBI-ProteinID: ACB22176
UniProt: B1M778
LinkDB All DBs
Position
150666..152189
Genome map
AA seq 507 aa AA seqDB search
MNKPEFLGDSKVKSPFSARYDNFIGGQWVAPAAGRYFENTSPITGKVVCEVARSDAQDVE
KALDAAHAAREAWGRTAPAERARILLKMADRMEENLDLLALAETWDNGKPIRETTHADIP
LAIDHFRYFAGCVRAQEGSISEIDHDTVAYHFHEPLGVVGQIIPWNFPILMAVWKLAPAL
AAGNCVVLKPAEQTPASVLVLAEIIGDLLPPGVLNIVNGFGLEAGKPLASSPRIAKIAFT
GETTTGRLIMQYASQNLIPVTLELGGKSPNIFFADVANEDDDFFDKALEGFTMFALNQGE
VCTCPSRALVHESIYDRFMERAVKRVEAITQGSPLDPATMIGAQASGEQMEKILSYIDIG
RQEGAQLLTGGERNVKDGEFAEGFYVKPTVFRGHNKMRIFQEEIFGPVLSVTTFKDDAEA
LSIANDTLYGLGAGVWTRDGTRAYRFGRAIQAGRVWTNCYHAYPAHAAFGGYKQSGIGRE
THKMMLDHYQQTKNMLVSYSAKKLGFF
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaacaagccggaattcctcggcgactcgaaggtcaagtcgcccttctcggcccgctac
gacaacttcatcggcggccagtgggtcgcccccgcggccggccgctacttcgagaacacc
tcgccgatcaccggcaaggtagtgtgcgaggtggcccggtcggacgcgcaggacgtcgag
aaggccctcgacgccgcccacgcggcccgggaggcctggggccgcacggcgccggccgag
cgcgcccgcatcctcctcaagatggccgaccggatggaagagaacctcgacctgctcgcg
ctggccgagacctgggacaacggcaagccgatccgcgagacgactcacgccgacatcccg
ctggccatcgaccatttccgctacttcgccggctgcgtgcgggcgcaggagggctcgatc
tccgagatcgaccacgacacggttgcctaccacttccacgagccgctgggcgtcgtcggc
cagatcatcccgtggaacttcccgatcctgatggcggtgtggaagctcgccccggcgctc
gccgccggcaactgcgtggtcctgaagccggccgagcagaccccggcctcggtcctggtg
ctggccgagatcatcggcgatctgctgccgccgggcgtgctcaacatcgtcaacggtttc
ggcctcgaggccggcaagccgctcgcctcgtcgccgcgaatcgccaagatcgccttcacg
ggtgagacgaccaccggccgcctcatcatgcagtacgcgtcgcagaacctgatcccggtg
acgctggagctcggcggcaagtcgccgaacatcttcttcgctgacgtggcgaacgaggac
gacgacttcttcgacaaggccctcgagggcttcacgatgttcgccctcaaccagggcgag
gtctgcacctgcccgagccgcgcgctcgtgcacgagtccatctacgaccggttcatggag
cgcgcggtgaagcgcgtcgaggcgatcacccagggctcgccgctggatccggccacgatg
atcggcgcccaggcctcgggcgagcagatggagaagatcctctcctacatcgatatcggc
cgccaagagggcgcgcagctcctcacgggcggtgagcgcaacgtcaaggacggcgagttc
gccgagggcttctacgtgaagccgaccgtgttccgcggccacaacaagatgcgcattttc
caggaggagatcttcgggccggtcctgtcggtcacgaccttcaaggacgatgccgaggcg
ctctccatcgccaacgacacgctctacggcctcggcgccggcgtctggacccgcgacggg
acccgcgcctaccgcttcggccgggcgatccaggcgggtcgcgtctggacgaactgctac
cacgcctacccggcccacgcggccttcggcggctacaagcagtccggcatcggccgcgag
acccacaagatgatgctcgatcactaccagcagaccaagaatatgctggtcagctactcg
gccaagaagctcgggttcttctga

DBGET integrated database retrieval system