KEGG   Methylobacterium radiotolerans: Mrad2831_0338Help
Entry
Mrad2831_0338     CDS       T00674                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
mrd  Methylobacterium radiotolerans
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N Glu_dehyd_C ADH_zinc_N 3HCDH_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: ACB22361
UniProt: B1LT55
LinkDB All DBs
Position
complement(369991..371049)
Genome map
AA seq 352 aa AA seqDB search
MLALRKATADFGADLVHVDAPTAPGAGRVTVTVAAAGICGSDIHAYEWTPGYGFMIPFMP
VTLGHEFAGTVRAVGDGVTGLAVGDRVTCWPTVPCGGCAACAAERPQDCQGRRVVGLHAD
GAFAEQVVVPADNCRRLPDGMPLAVAALAEPLAVAVNAVDVAEVGTGDRVAVLGPGPIGL
SIAFVAQHRGADVLLAGLDDTARLDLARRIGIRATADLAGVGLDDAVRRTFDGEADRVIE
ATGSARSVVDGMGVLRSGGVMVVAGIHSGSLDLDLTGFVRSKKQLRAAHDTTARAFDAAI
ALLADHAGTLEALITHRRPLAEAWAAFDLARSRQAMKVLLLPEAAGSQGAER
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcgttgcgcaaggcgacggccgacttcggggctgacctcgtccacgtcgatgcg
cccaccgctccgggggctggccgcgtgaccgtcacggtcgccgcggccggcatctgcggc
agcgacatccacgcctacgagtggacccccggctacgggttcatgatccccttcatgccg
gtcaccctcggccacgagttcgccgggacggtccgcgccgtgggagacggcgtgaccggg
ctcgccgtcggcgaccgggtcacctgctggccgacagtgccgtgcggcggctgcgcggcc
tgcgcggccgagcggccgcaggattgccagggaaggcgagtcgtcggcctgcacgcggac
ggggccttcgccgagcaggtcgtcgttccggccgataattgccgccgcctgcccgacggg
atgccgctggccgtcgcggcgctggccgagccgctggcggtcgcggtcaacgcggtggac
gtggcggaggtcgggacgggcgaccgcgtggcggtgctcggcccgggcccgatcggcctc
agcatcgccttcgtggcgcagcatcggggcgcggacgtgctgctcgccggtctcgacgac
accgcgcgcctcgacctcgctcgccggatcggcatccgcgcgacggccgatctcgccggc
gtcggcctggacgacgccgttcggcgcaccttcgacggggaggctgaccgggtgatcgag
gcgacgggatccgcccgatcggtggtcgacgggatgggcgtgctgcgttccggcggcgtg
atggtggtggcaggcatccactccggatccctcgacctcgacctgacgggtttcgtgcgc
agcaagaagcagctgcgcgcggcccacgacacgacggcgcgcgccttcgacgccgcgatc
gcgctcctcgcggaccatgccgggacgctggaggcgctgatcacgcaccgtcgtcccctc
gcggaagcctgggcggcgttcgatctggcgcggagccggcaggccatgaaggtgctgctt
cttcccgaagcggcggggagccagggggccgagcgatga

DBGET integrated database retrieval system