KEGG   Methylobacterium radiotolerans: Mrad2831_1598Help
Entry
Mrad2831_1598     CDS       T00674                                 

Definition
(GenBank) trehalose synthase
  KO
K05343  maltose alpha-D-glucosyltransferase / alpha-amylase [EC:5.4.99.16 3.2.1.1]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00500  Starch and sucrose metabolism
mrd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Mrad2831_1598
Enzymes [BR:mrd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     Mrad2831_1598
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.16  maltose alpha-D-glucosyltransferase
     Mrad2831_1598
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Malt_amylase_C APH hDGE_amylase DUF3459
Motif
Other DBs
NCBI-ProteinID: ACB23593
UniProt: B1M6D3
LinkDB All DBs
Position
complement(1692987..1696265)
Genome map
AA seq 1092 aa AA seqDB search
MIDRSDPQWYRDAIIYQIHVKSFFDSNNDGIGDFVGLTQRLDYVRDLGVTAIWLMPFYPS
PLRDDGYDIADYRDINPSYGTMEDFKAFVEAAHERGLRVITELVINHTSDQHPWFQAARE
APPGSPERNFYVWSDTDEPYKDTRIIFLDTEASNWTWDPVAKQYFWHRFYSHQPDLNFDN
PAVLEAVIEVMRYWLDMGVDGLRLDAIPYLIERDGTNCENLAETHEVIKKIRAALDAEYP
DRMLLAEANQWPEETAQYFGDGDECHMAFHFPLMPRMYMAIAREDRHPITDIMRQTPEIP
EGCQWAIFLRNHDELTLEMVTAEERDYLWSFYAAERRARINLGIRRRLAPLLENDRRKIE
LMKSLVLSMPGTPVLYYGDEVGMGDNIYLGDRDGVRTPMQWSPDRNGGFSRANPQKLFLP
AIQDPIYGFDAINVEAQTQAQTSLLNWTRRMIAIRNNSVALGRGTIQFLYPSNRKVLAWI
REHEDERILCVANLSRAPQAVQLDLSELRTAVPIELTGGTEFPPIGDLPYLLTLPSYGFY
WFSLSAARSGVVGPQQEPPELFTLVLTGGIETLMSGRERVAFERTVVPPFLTSRRWFGAK
GSRIKATKVVDCAALKDVDGSARFLLPRLQVQLASGETQEYFVPVGVEEGREDETLMPFA
VARVRRGPRTGLLYGAAGSNDFAACLIDDMRQAREIPTETGRLVFAVTSAFDPDVTVDVA
DIRRLSGEQSNTSIAIGSKMMLKLLRRLQPGLHPEIEVGRFLTEQAGFSNTPALLGTLEH
VAEDGTRTALAVLQKFVMNQGDAWTLMLEGLRRDFETVVLTPESEAATPEEAFQAHRPWA
DLLGRRTAELHAALAIETDDPAFAAEPFTGDDLAVLARDARHQAERAFRALKGLADRGLD
AGKPACAELGRRRGEVEALIGSLTAAPVRGAHKTRIHGDYHLGQVLVAENDLIIVDFEGE
PSRPADERRAKSMPLRDVAGLMRSFAYGAETVIREITARFADSEERARDAATAWRGMIEA
AFLAGYETAVEGSRAAVTDADSRARLLRLCLLTKALYEVDYEANNRPDWIEIPARGVLTI
LDTDGHEPGASE
NT seq 3279 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatcgcagcgacccgcaatggtaccgtgacgccatcatctaccagatccacgtc
aagtcgttcttcgactcgaacaacgacgggatcggggatttcgtgggcctgacccagcgc
ctcgactacgtgcgcgacctcggcgtcacggcgatctggctgatgccgttctacccctcg
cccctgcgcgacgacggctacgacatcgccgattaccgggacatcaacccgtcctacggg
accatggaggacttcaaggccttcgtggaggcggcgcacgagcgcggcctgcgggtcatc
accgagctcgtcatcaaccacaccagcgaccagcatccctggttccaggccgcccgcgag
gcgccgcccggctcgccggagcgcaacttctacgtctggtcggacaccgacgagccgtac
aaggacacacgcatcatcttcctcgacaccgaggcgtcgaactggacctgggacccggtc
gccaagcagtatttctggcaccggttctacagccaccagccggacctgaacttcgacaac
ccggccgtgctggaggccgtgatcgaggtgatgcgctactggctcgacatgggcgtcgac
gggctgcggctcgacgcgatcccctacctgatcgagcgcgacggcacgaactgcgagaac
ctcgccgagacccacgaggtcatcaagaagatccgcgccgcgctggacgccgagtatccg
gaccggatgctgctcgccgaggccaaccagtggccggaggagaccgcccagtacttcggc
gacggcgacgagtgccacatggcgttccacttcccgctgatgccgcggatgtacatggcg
atcgcccgggaggaccggcacccgatcaccgacatcatgcgccagaccccggagatcccc
gagggctgccagtgggccatcttcctgcgcaaccacgacgagctgacgctcgagatggtc
acggccgaggagcgtgactacctctggtcgttctacgccgccgagcggcgggcccggatc
aacctcggcatccgccgccgcctcgcgccgctcctcgagaacgaccggcgcaagatcgaa
ttgatgaagtccctcgtcctgtcgatgcccggcacgccggtgctctactacggcgacgag
gtcggcatgggcgacaacatctatctcggcgaccgcgacggcgtgcgcacgccgatgcag
tggagccccgaccgcaacggcggcttctcccgggcgaacccgcagaagctgttcctgccg
gcgatccaagacccgatctacggcttcgacgccatcaacgtcgaggcgcagacccaggcc
cagacgagcctcctgaactggacgcggcgcatgatcgcgatccgcaacaacagcgtcgcg
ctgggacgcggcacgatccagttcctgtacccgtcgaaccgcaaggtcctggcctggatc
cgcgagcacgaggacgagcggatcctgtgcgtggcgaacctgtcgcgggcgccgcaggcg
gtgcagctcgacctgtcggaactgcgcaccgcggtgccgatcgagctcaccggcggcacc
gagttcccgccgatcggcgacctgccctacctgctgaccctgccgtcctacggcttctac
tggttcagcttgagcgccgcgcgctccggggtggtcggcccgcagcaggagccgccggag
ctgttcaccctggtgctcaccggcgggatcgagaccctgatgagcgggcgcgagcgcgtc
gccttcgagcgcaccgtggtgccgccgttcctgacgagccggcgctggttcggcgccaag
ggctcgcggatcaaggccacgaaggtcgtcgactgcgccgccctgaaggacgtcgacggc
agcgcgcgcttcctgctgccgcggctgcaggtgcagctcgccagcggcgagacccaggaa
tacttcgtgcccgtgggcgtcgaggagggccgcgaggacgagaccctcatgcccttcgcg
gtggcgcgggtgcgccggggaccgcgcaccggcctgctctacggcgcggccggctccaac
gacttcgccgcctgcctgatcgacgacatgcggcaggcccgcgagatccccacggagacc
gggcgactcgtcttcgccgtcacctcggccttcgacccggacgtcacggtcgacgtggcc
gacatccgccggctctcgggcgagcagagcaacacctcgatcgccatcggctcgaagatg
atgctcaagctgctgcgccgcctgcagccaggcctgcaccccgagatcgaggtcgggcgc
ttcctcaccgagcaggcgggcttctccaacaccccggccctgctcggcaccctggagcat
gtcgccgaggacggcacccgcacggccctcgcggtcctgcagaagttcgtcatgaaccag
ggcgacgcctggaccctgatgctggagggcctgcgccgggacttcgagaccgtggtgctg
accccggagagcgaggccgcgacccccgaggaggcgttccaggcccaccggccctgggcc
gacctgctgggccggcgcaccgccgagctgcacgcggcgctcgccatcgagaccgacgac
ccggccttcgcggccgagccgttcaccggggacgacctcgccgtgctggcgcgcgacgcc
cgccaccaggccgagcgcgccttccgggcgctcaagggcctcgccgaccggggcctcgac
gccggcaagccggcctgcgcggagctcggccggcgccggggcgaggtcgaggcgctgatc
gggtcgctcaccgccgcgccggtccggggcgcccacaagacccgcatccacggcgactac
cacctgggccaggtgctggtcgccgagaacgacctgatcatcgtcgacttcgagggcgag
ccctcgcgcccggccgacgagcgccgggccaagtcgatgcccctgcgggacgtcgccggg
ctgatgcgctccttcgcgtacggcgccgagacggtgatccgggagatcaccgcgcggttc
gccgactccgaggagcgggcgcgggacgcggcgaccgcgtggcgcggcatgatcgaggcg
gcgttcctggcgggctacgagaccgcggtcgagggctcccgggcggcggtgaccgacgcg
gattccagggcccggctgctgcgcctctgcctgctgaccaaggccctctacgaggtcgac
tacgaggccaacaaccggccggactggatcgaaatccccgcccgtggggttctcaccatt
ctggacacggacggacacgagcccggagcatctgaatga

DBGET integrated database retrieval system