KEGG   Methylobacterium radiotolerans: Mrad2831_3050Help
Entry
Mrad2831_3050     CDS       T00674                                 

Definition
(GenBank) carbohydrate kinase, YjeF related protein
  KO
K17758  ADP-dependent NAD(P)H-hydrate dehydratase [EC:4.2.1.136]
Organism
mrd  Methylobacterium radiotolerans
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mrad2831_3050
Enzymes [BR:mrd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.136  ADP-dependent NAD(P)H-hydrate dehydratase
     Mrad2831_3050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Carb_kinase Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: ACB25032
UniProt: B1M5K2
LinkDB All DBs
Position
complement(3218985..3219863)
Genome map
AA seq 292 aa AA seqDB search
MKHTPLTAASLREHPLPLPQAGSKDARGRALVVAGSASVPGAALLAAVAALRAGAGRLRI
ATVARAAAGMGLMVPEAMVVGLPETADGAVDVAQAATSLRTLADGCDAVLIGPGMLGEAP
TAALAVELLGADASFILDATALSELRARAGAVRARAGRAVVTPHAGEMARLLDRRREAVE
ADPLEAARAAAELLGSVVVMKGASTWIVEPQGGRWLYAGGGIGLATSGSGDVLAGLIVGL
LARGLPPISAALWGVFLHGEAGRRLAGAIGPVGFLARELPGVVPELMRETMG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacacgcccctcacggccgcttctctccgggagcacccgctgccgctcccgcaa
gcggggagcaaggacgcgcgcggcagggcgctcgtggttgccggctcggcctcggtcccg
ggggcggccctgctggccgccgtcgccgccctgcgcgcgggcgccgggaggctgaggatc
gcgaccgtcgcgcgcgcggccgccggcatgggactgatggtgcccgaagccatggtcgtc
ggattgccggagaccgcggatggcgccgtcgatgtcgcgcaggctgcgaccagcctgcgg
acgctggcggacggatgcgacgccgtcctgatcgggcccggaatgctcggcgaggcgccg
accgcggcactcgcggtcgagctgctcggcgccgacgcgtccttcatcctcgacgccacc
gcactgtccgagctccgcgcccgtgcgggggccgtcagggcccgcgccgggcgggcagta
gtcacgccccatgccggcgagatggcgcggctcctggaccgccgccgcgaggcggtggag
gcggatccgctcgaggcggcgcgcgcggcagccgagcttctgggatcggtcgtggtgatg
aagggggcgtcgacgtggatcgtggagccgcagggcggtcgctggctctatgccggcggt
ggcatcggcctcgcgacgtcgggctcgggcgacgttctggccggcctcatcgtcgggctc
ctcgcgcgcggcctgccgccgatctcggccgctctctggggcgtgttcctgcacggcgaa
gccggccggcgcctcgccggggcgatcggcccggtcggcttccttgcccgggaactgccg
ggcgtcgtgccggaactgatgcgagagacgatgggctag

DBGET integrated database retrieval system