KEGG   Methylobacterium radiotolerans: Mrad2831_3564Help
Entry
Mrad2831_3564     CDS       T00674                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Mrad2831_3564
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mrd02000]
    Mrad2831_3564
Enzymes [BR:mrd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     Mrad2831_3564
Transporters [BR:mrd02000]
 Other Transporters
  Pores ion channels [TC:1]
   Mrad2831_3564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_3 GST_N GST_C_2 GST_N_2 GST_C Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ACB25540
UniProt: B1LUV4
LinkDB All DBs
Position
complement(3783070..3783705)
Genome map
AA seq 211 aa AA seqDB search
MPDIELYHSPNTRSSGVRVLLEELGVPYRLHALNMRAGEHLQDAYRAVNPMAKVPAIRHG
DALVTEQAAVYLYLADLFPEAGLAPAPTEPGRATYLRWMVFYGSCFEPAVIDRYLQREPG
PRALSAYADYDSVIARVRGALTPGPYLLGARFSAADVLWGGALGWTTGFGLVAPDPVLSA
YVERIRSRPASRKVAAADAQLAEAHQAAAPA
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcctgacatcgagctctatcattcgcccaatacccgctcgtcgggcgtgcgcgtgctg
ctcgaggaactcggcgtcccgtaccggctgcacgcgctcaacatgcgcgccggcgagcac
ctccaggacgcctaccgcgccgtcaacccgatggcgaaggtgccggcgatccgccacggc
gacgccctggtgaccgagcaggcggccgtctacctctacctcgccgacctgttccccgag
gcggggctcgccccggcgccgaccgagcccggccgggccacctacctgcgctggatggtg
ttctacggctcctgcttcgagccggcggtgatcgaccggtaccttcagcgggagccgggc
ccgcgcgccttgtcggcctacgccgattacgacagcgtcatcgcgcgggtgaggggggcc
ctgacgcccggcccgtacctgctcggcgcgcgcttcagcgccgccgacgtgctgtggggc
ggcgccctcggctggacgacgggcttcggcctcgtcgcgcccgatccggtgctgagcgcc
tacgtggagcgcatccggtcccgcccggcctcccggaaggtcgcggccgcggacgcgcag
ctcgccgaggcgcaccaggcggccgcgcccgcctga

DBGET integrated database retrieval system