KEGG   Methylobacterium radiotolerans: Mrad2831_3664Help
Entry
Mrad2831_3664     CDS       T00674                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00620  Pyruvate metabolism
mrd00680  Methane metabolism
mrd00710  Carbon fixation in photosynthetic organisms
mrd01100  Metabolic pathways
mrd01120  Microbial metabolism in diverse environments
mrd01200  Carbon metabolism
Module
mrd_M00168  CAM (Crassulacean acid metabolism), dark
mrd_M00346  Formaldehyde assimilation, serine pathway
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Mrad2831_3664
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Mrad2831_3664
   00680 Methane metabolism
    Mrad2831_3664
Enzymes [BR:mrd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Mrad2831_3664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: ACB25640
UniProt: B1LVZ0
LinkDB All DBs
Position
complement(3893353..3896103)
Genome map
AA seq 916 aa AA seqDB search
MTRTLHATPGLVDATAFAPPVIVGTSSEQALDILFQALLDVARRHDPDLEAVLHGTADIS
RFSPQMLARALQVQGIWFQLISIAEQNAAMRRRRHVERTEGRAALSGSFAKVFADARKQG
VPPEKIQALLTDLRIRPTLTAHPTEGKRVTVLEKFRRIYLVLRELEMPRWTDRERNGLMN
ELRDQIELVWMTGELHLEKATVEREVAWGLHFFDETLFEMLPETLEALHEALAETYPGTE
FRVPPFFQFGSWIGGDRDGNPYVTAAVTRQTLHRNALASLTRYRDRVRELGRTLSLTERS
LPLPEGFRAELDRQLAESGQARAITRRNPGEPYRQYLSCVLRKIEATIARNEGEHPSGPD
YASADGLIEDLRTLERGLTEAKCGALARDLVRPVRRMVEIFRFSTVRLDLRENTTRTTDT
LHALWRQRNGDGEPPALGSAAWRQWLDAELARPRDPERSFEDLPDAARETLATFALVAEM
REALDREAFGAFVLSMTRSVEDVLGAYLLAKEAGVFLDAAGTEICPLPIVPLFETIDDLR
AAPAIMRALLGTPVVRRSTRWQGGVQEVMIGYSDSNKDGGFVAANWELYKAQSKLTRLGE
ELGVGIAFFHGRGGSVSRGGVPTHRGIMAQPPGSIRGRFRTTEQGEVVSFKYANRGTAAY
QMELLAASVFEHALAGDGERVGPGHDDALEALAGASRAAYVQLLQTDGLVDYFQAASPLD
EIALLNIGSRPARRFGARALSDLRAIPWVFAWSQNRHVITGWYGVGSGLASFIDVRGRDG
EAALKRLFTESRILRLVLDEVEKTLMMVDLDIARAYAGLVPDPGPRDRIFSMIEAEYALT
REMVLRVSGGTELAERFPLFRDRLKGRLPTINQVSREQVELLARYRAETDEDRREAVKSA
LLLSINCIAVGFGATG
NT seq 2751 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcacgcttcacgcaacccccggtctcgtcgatgccacggccttcgcgccgccg
gtgatcgtcggcacgtcgtcggagcaggcgctggacatcctgttccaggcgctgctcgac
gtcgcccgccggcacgaccccgacctcgaggcggtcctgcacggcacggccgacatctcg
cgcttctcgccgcagatgctcgcacgcgcgctgcaggttcagggcatctggttccagctg
atctccatcgccgagcagaacgccgcgatgcgccgccgccggcacgtcgagcgcacggag
gggcgggccgcgctcagcggctcgttcgcgaaggtcttcgctgacgcgcgcaaacagggg
gtgccgcccgagaagatccaggcgctcctcaccgacctgcgcatccgcccgacgctgacc
gcccatcccaccgagggcaagcgcgtcacggtgctggagaagttccgccggatctacctc
gtgctgcgcgaactggagatgccgcgctggaccgatcgcgagcgcaacgggctcatgaac
gagctgcgcgaccagatcgagctggtctggatgacgggcgagctgcacctggagaaggcg
accgtcgagcgggaggtggcctggggcctgcacttcttcgacgagaccctgttcgagatg
ctgcccgagaccctggaggcgctgcacgaggcgctggccgagacctatccgggcacggag
ttcagggtgccgccgttcttccagttcggctcgtggatcggcggcgaccgggacggtaac
ccctacgtcaccgccgcggtcacgcggcagaccctgcaccgcaacgcgctcgcctcgctc
acccgctaccgcgaccgcgtgcgcgagttgggccggaccctgtcgctcaccgagcgctcg
ctgccgctgcccgagggcttccgcgcggagctcgaccggcagctcgccgagagcggccag
gcccgcgccatcacccggcgcaacccgggcgagccctaccgacagtacctgtcctgcgtc
ctgcgcaagatcgaggcgacgatcgcccgcaacgagggcgagcacccgtccggtcccgat
tatgccagcgcggacgggctgatcgaggatctgcgcaccctggagcgcggcctgaccgag
gccaagtgcggggcgctggcgcgcgatctcgtccgcccggtgcggcggatggtcgagatc
ttccggttctcgacggtccggctcgacctgcgcgagaacaccacccggaccaccgacacg
ctccacgccctctggcgccagcgcaacggcgacggcgagccgccggccctcggctcggcc
gcgtggcgccagtggctcgacgcggagctcgcccggccgcgcgatcccgagcggtccttc
gaggatctgcccgacgccgcccgcgagacgctcgccaccttcgccctcgtggccgagatg
cgcgaggccctcgaccgcgaggcgttcggcgccttcgtgctgtcgatgacccgctcggtg
gaggacgtgctcggcgcgtacctgctggccaaggaggcgggggtgttcctcgacgccgcc
ggcacggagatctgcccgctgccgatcgtgcccctgttcgagaccatcgacgacctgcgc
gccgccccggcgatcatgcgggcgctgctcgggacgccggtggtgcgccgctcgacccgc
tggcagggcggggtgcaggaggtgatgatcggctactccgactccaacaaggacggcggc
ttcgtcgccgccaactgggaactctacaaggcgcagagcaagctgacccgcctcggcgag
gagctcggcgtcgggatcgccttcttccacgggcgcggcggctcggtgagccgcgggggc
gtgccgactcaccggggcatcatggcccagccgccgggctccatccgcggccggttccgc
accaccgagcagggcgaggtcgtctcgttcaagtacgccaaccgcggcaccgccgcctac
cagatggagctgctggcggcctcggtgttcgagcacgcgctggcgggcgacggcgagcgg
gtggggccgggccacgacgacgccctggaggcattggccggcgcctcgcgggcggcctac
gtccagctgctccagaccgacggcctcgtcgactacttccaggcggcgagccccctggac
gagatcgcgctcctcaacatcggctcccgcccggcccgccgcttcggcgcgcgcgcgctc
tcggacctccgggcgatcccctgggtgttcgcgtggtcgcagaaccggcacgtgatcacc
ggctggtacggggtcggatcggggctcgcgagcttcatcgacgtgcgcggtcgggacggc
gaggcggcgctcaagcggctgttcaccgaatcccgcatcctccgcctcgtcctcgacgag
gtcgagaagacgctgatgatggtcgatctcgacatcgcccgcgcctacgcgggcctcgtc
ccggacccgggaccccgggaccggatcttctcgatgatcgaggccgagtacgcgctcacc
cgcgagatggtgctgcgggtgagcggcggcacggagctggccgagcgcttcccgctgttc
cgggaccgcctgaagggccggctcccgaccatcaaccaagtgagccgcgagcaggtcgag
ctgctcgcccgctaccgtgcggagaccgacgaggatcggcgcgaggcggtgaagtcggcc
ctgctcctgtccatcaactgcatcgcggtcggcttcggggcgaccgggtag

DBGET integrated database retrieval system