KEGG   Methylobacterium radiotolerans: Mrad2831_5525Help
Entry
Mrad2831_5525     CDS       T00674                                 

Definition
(GenBank) enoyl-acyl carrier protein reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mrd  Methylobacterium radiotolerans
Pathway
mrd00061  Fatty acid biosynthesis
mrd00780  Biotin metabolism
mrd01100  Metabolic pathways
mrd01130  Biosynthesis of antibiotics
mrd01212  Fatty acid metabolism
Module
mrd_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mrd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Mrad2831_5525
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Mrad2831_5525
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Mrad2831_5525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mrd01004]
    Mrad2831_5525
Enzymes [BR:mrd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Mrad2831_5525
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     Mrad2831_5525
Lipid biosynthesis proteins [BR:mrd01004]
 Fatty acid synthase
  Component type
   Mrad2831_5525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short
Motif
Other DBs
NCBI-ProteinID: ACB27470
UniProt: B1M0E8
LinkDB All DBs
Position
5839358..5840182
Genome map
AA seq 274 aa AA seqDB search
MAEHGQGLLAGKRGIVLGVANNRSIAWGIARSARAHGAELAFTYQGDALRKRVEPLAKEL
DAHVIGHCDVTESATIDAVFAEAAKVFPDGIDFVVHCVAFSDKDELTGRYIETSEDNFTK
SLLVSCYSFTAVAQRAEKIMRPGGSLVTLTYYGAEKWMPHYNVMGVAKAALEASVRYLAA
DLGPKNIRVNAISAGPIKTLAASGIGDFRYILKWNEYNAPLRRTVTIGEVGETASYLVSD
MAAGMTGEILHVDAGYHVVGMKNPEAPDLTLDKD
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggcggaacacgggcagggccttctggcgggcaagcggggcatcgtcctcggggtcgcc
aacaaccgctcgatcgcctggggcatcgcccgcagcgcccgcgcccacggggccgaactg
gccttcacctaccagggcgacgccctgcgcaagcgcgtggagcccctcgccaaggaactc
gacgcccacgtgatcgggcactgcgacgtcaccgagtcggccacgatcgacgcggtcttc
gcggaggccgcgaaggtcttccccgacggcatcgacttcgtcgttcactgcgtcgccttc
tccgacaaggacgagctgacgggccgctacatcgagacctccgaggacaactttaccaag
tcgctcctggtctcgtgctactcgttcaccgcggtggcccagcgcgccgagaagatcatg
cgcccgggcggctcactggtgacgctgacctattacggcgccgagaagtggatgccgcac
tacaacgtcatgggcgtcgccaaggcggcgctggaggcgtcggtgcgctacctcgcggcc
gatctcggaccgaagaacatccgggtcaacgcgatctcggccggcccgatcaagaccctc
gccgcctcgggcatcggcgatttccgctacatcctgaagtggaacgagtacaacgcgccc
ctgcgccggaccgtgacgatcggcgaggtcggcgagaccgcgtcctacctcgtctccgac
atggcggccgggatgaccggcgagatcctccacgtggatgccggctaccacgtggttggc
atgaagaaccccgaggcgccggacctcaccctcgacaaggattga

DBGET integrated database retrieval system