KEGG   Meiothermus ruber DSM 1279: K649_00945Help
Entry
K649_00945        CDS       T02636                                 

Definition
(GenBank) enoyl-ACP reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
mre  Meiothermus ruber DSM 1279
Pathway
mre00061  Fatty acid biosynthesis
mre00780  Biotin metabolism
mre01100  Metabolic pathways
mre01130  Biosynthesis of antibiotics
mre01212  Fatty acid metabolism
Module
mre_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mre00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    K649_00945
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    K649_00945
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    K649_00945
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mre01004]
    K649_00945
Enzymes [BR:mre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     K649_00945
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     K649_00945
Lipid biosynthesis proteins [BR:mre01004]
 Fatty acid synthase
  Component type
   K649_00945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR Arm-DNA-bind_2 Polysacc_synt_2
Motif
Other DBs
NCBI-ProteinID: AGK03499
UniProt: D3PLT3
LinkDB All DBs
Position
complement(165940..166734)
Genome map
AA seq 264 aa AA seqDB search
MVPIDLSGKKALVMGVTNEHSLGWAIAEKLYAAGAEVAFSYQGERLREKLEKLTAGRPNQ
RLYQVDVTDEAALKAMFADLGQAWGGLDYLVHSIAFAPRAAMEGRFIDTTAADWNTALQV
SAYSLVAVAREAEPLLREGGSLVTLTYYASEKVVPRYNVMGIAKAALEASVRYLAYELGK
KNIRVNAISAGAIRTVAAMSIPGFRKMVAKYNATAPLGRMITHEEVGNLGLYLLSPLSSG
TTGQTVYVDAGYSIMGMSWDDVQE
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggttccgattgatctgtccggtaaaaaagccctggtcatgggcgtaaccaacgagcat
agcctgggctgggctatcgccgaaaagctgtatgccgctggggccgaggtggccttcagc
taccagggcgagcggctgcgggaaaagctggaaaaactcaccgcgggtcgtccaaaccag
cgcttgtaccaggtggatgtcaccgacgaagccgccctcaaggccatgttcgccgacctg
gggcaggcctggggcggcctcgactatctggtgcactccatcgcctttgccccccgcgcc
gccatggaaggacgcttcatcgacaccaccgccgccgactggaataccgccctgcaggtc
tcggcctactcgctggtcgctgtggcccgcgaagccgagccgctgctccgcgaggggggt
agcctggtcaccctgacctactacgcctccgaaaaggtggtgccccggtacaacgtgatg
ggcattgccaaggctgccctggaagccagcgtgcgctacctggcctatgagctgggcaag
aaaaacatccgggtcaacgccatcagcgccggggctattcgcaccgtggcggccatgagc
atccccggcttccgcaagatggtggccaagtacaacgccacagcccccctggggcgcatg
attacccacgaggaagtgggcaacctgggcctgtacctgctctcccccctatccagcggc
accaccggccagaccgtctacgtggacgcgggctacagcatcatgggcatgagctgggat
gacgtgcaggagtag

DBGET integrated database retrieval system