KEGG   Mycolicibacterium rhodesiae: MycrhN_0030
Entry
MycrhN_0030       CDS       T01685                                 

Definition
(GenBank) pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric
  KO
K03737  pyruvate-ferredoxin/flavodoxin oxidoreductase [EC:1.2.7.1 1.2.7.-]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00010  Glycolysis / Gluconeogenesis
mrh00020  Citrate cycle (TCA cycle)
mrh00620  Pyruvate metabolism
mrh00650  Butanoate metabolism
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
mrh01120  Microbial metabolism in diverse environments
mrh01200  Carbon metabolism
Module
mrh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MycrhN_0030
   00020 Citrate cycle (TCA cycle)
    MycrhN_0030
   00620 Pyruvate metabolism
    MycrhN_0030
   00650 Butanoate metabolism
    MycrhN_0030
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MycrhN_0030
    1.2.7.-  
     MycrhN_0030
SSDB
Motif
Pfam: POR_N POR EKR PFOR_II Fer4 TPP_enzyme_C Fer4_16 Fer4_7 Fer4_21 Fer4_6 Fer4_9 Fer4_2 Fer4_17 Fer4_8 Fer4_10 Fer4_15 Fer4_18 Fer4_13 Fer4_22 Fer4_4 Fer4_3
Other DBs
NCBI-ProteinID: AEV70682
UniProt: G8RXY9
LinkDB
Position
31222..34794
AA seq 1190 aa
MTRATVDGNEATVSVAYRLNEVCCIYPITPSSPMAELADEWSSAQRTNVWGNVPTVVEMQ
SEAGAAGALHGSLQSGALATTFTSSQGLLLMIPNMYKIAGELTSAVINVAARSVAAQGLS
IFGDHSDVMAVRQTGFALLGSASVQEAHDLALVAQAATLTTRIPFVHFFDGFRTSHEINT
IETLTDDDLRALVPEELVHAHRGRALTPERPFIRGTAQNPDVYFQARETVNPFYARVPDV
VESLMARLGERTGRTMHILDYEGHPAAEHVLVLMGSGAETVKQTVGALVERGERVGVVQV
RLYRPFPTRAFLDALPTSVRTVGVLDRTKEPGSIGEPLYLDVVAALAEAHADGERPVMPR
AIGGRYGLSSKEFTPAMVAGVFAELAREQPRRRFTIGIDDDVSGSSIEYDPSFGIESPDT
VGAIFFGLGSDGTVSANKNTIKILGAHEGLHAQAYFVYDSKKSGSQTESHLRFGPHPIRA
PYLVTAANFVGCHQFRFLDKVDVLDRAAPGATLLLNCRLRSAKVWDALPRRVQEQILDKR
ITLYTVDADRIAREAGLAGRINIVLQTCFFVISEVLPQEQAIARIKESVAKTYGNRGADV
LSKELAAVDAAVAGLQRIEVPALVTSTRMPAPLVPESAPEFVRTVTAEMMAGRGNLLPVS
ALPVDGTYPSGTTAYEKRNISDLVAVWDPDSCIQCGNCAFVCPHSVIRSKFYDESQLTEA
PEEFDSAPLDAVGLPNARFSLQVYAEDCTGCGLCVEACPVVIPGGAVTKAINLGPAEPRV
DTERKNIEFFESLPTNDRSRVDFGTVRGTQFLEPLFEFSGACAGCGETPYLKLLSQLFGD
RLMVANATGCSSIYGGSLPTTPWTTNAAGRGPAWSNSLFEDNAEFGLGLRLAGDAHVQLA
RRRLAELRDPLGADLVDAILAAPQQRESELAAQRERLGELKDRLRGLDPVSAADLLSVVD
HLIRRSVWIVGGDGWAYDIGSGGLDHVLSTGRNVNVLVLDTEVYSNTGGQMSKATPLGAV
AKFASAGKTVPLKDLALQAIAYGSVYVAKVAMGADPQQTLQAFREAEAYDGPSLIIAYSQ
CIAHGIDMRLGMDQQYRAVASGHWPLLRYNPVLRATGENPFLLDSHRPRIPLDDYRKREL
RYRSLANAEPVEYERLLGMAEQMIAQRWNVYEEMASRGPQSFQPDARREH
NT seq 3573 nt   +upstreamnt  +downstreamnt
atgacccgcgcaacggtggacggtaacgaggcaaccgtctcggtcgcctaccgactcaac
gaagtgtgctgcatctacccgatcacgccgtcgtcgccgatggctgaactcgccgacgaa
tggtccagcgcacaacgaaccaacgtatggggcaacgtccccaccgtggtcgaaatgcaa
agcgaggcaggcgccgcgggcgcgctgcacgggtcgctgcagagcggtgcgttggcgacg
acgttcacctcgtcccagggcctgctcctgatgattccgaacatgtacaagatcgccggc
gaactgacctcggccgtcatcaacgtggcggccagatcggtcgccgcgcagggcttgtcg
atcttcggtgaccactcggacgtgatggctgtgcgccagacgggcttcgcgttgctcggg
tccgcctccgtgcaggaggctcacgacctcgcactcgtcgcgcaggcagccacgctgacg
acccggataccgttcgtgcacttcttcgacggattccgaacttcccacgagatcaacacc
attgagacgctgaccgacgatgacctgcgggccttggtgcccgaggaactggtgcacgcg
catcgcggacgggcgttgaccccggaacggcccttcatccgcggaaccgcccagaatccg
gacgtctacttccaggcccgcgaaacggtcaacccgttttacgcgcgggtcccagatgtg
gtcgaaagcctgatggcccgcctcggcgagcgcaccggccggacgatgcacatcctcgac
tacgagggacaccccgcggcggaacacgttctggtgctgatgggttcgggcgccgagacg
gtcaagcagaccgtcggcgcacttgtcgaacgcggcgaacgggtcggcgtggtgcaggtg
cggctgtaccggccgttccccacccgagcattcttggacgcattgccgacgtcggtgcga
acggtcggggtgctggaccgcaccaaggaacccggctcgatcggcgaacccctgtacctg
gacgtcgtcgctgcgctggctgaggcacatgccgacggcgagcgcccggtgatgccgcgg
gcgatcgggggacgctatggcctgtcctccaaggaattcacccccgccatggttgccggc
gtgttcgccgagctcgcccgcgagcaaccgcggcggcggttcaccatcggtatcgacgac
gacgtctccgggtccagcatcgagtacgacccgtcgttcggtatcgagtcgccggatacc
gtcggcgcgatcttcttcgggttgggttcggacggcaccgtcagcgcgaacaagaacacc
atcaaaatcctcggagcccacgaaggtctgcacgcgcaggcctacttcgtctacgactcc
aagaagtcaggatcgcagaccgaatcgcacctgcgcttcggaccgcaccccatccgcgcc
ccctacctggtgaccgcagccaatttcgtcgggtgccatcagttccgcttcctcgacaag
gtcgatgtgctggatcgggccgcccccggcgcgacgctgctgctcaactgcaggctgcgt
tcagcaaaggtctgggacgcgctgccgcggcgagtacaggaacagatcctggacaagcgg
atcacgctctacaccgtcgacgccgaccgcatcgcgcgcgaggcagggctggccggccgc
atcaacatcgtccttcagacctgtttcttcgtgatctcggaggtgctgccgcaagagcag
gccatcgcgaggatcaaggaatcggtagcgaagacgtacggcaaccgcggcgccgacgtg
ctgagcaaggagctggcagcggtggacgccgccgtggccgggttgcagcggatcgaggta
cctgccctcgtcacctccacccgcatgccggcgccactcgtgcccgagtcggcaccggag
ttcgtccgcaccgtgaccgcggagatgatggccggccgcggaaacctactgccggtcagc
gcacttccggtggacggcacctaccccagcggcacgacggcctacgagaagcgcaatatc
tccgacctggtggcggtgtgggatccggacagctgcatccagtgcggcaactgcgcgttc
gtctgcccgcacagtgtgatccggtccaagttctatgacgaatcacaactgaccgaggcg
cctgaggagttcgactccgcgccgctggatgcggtcggcctgcccaacgccaggttctcg
ctgcaggtgtacgccgaggactgtacgggctgcggcttgtgtgtcgaggcctgcccggtc
gtcattcccggcggcgccgtcaccaaggcgatcaacctcggtcccgccgagccgcgagtg
gacaccgagcgcaagaacatcgagttcttcgaatcgctgccgaccaacgaccgctcgcgt
gtggacttcggcacagttcgtggaacccagttcctcgagccgcttttcgagttctcaggt
gcatgcgctggttgcggcgagactccgtacctcaaactgctctcccagctgttcggagac
cggctcatggtcgccaacgcgaccggctgctcgtccatctacggcggcagcctgcccacc
actccctggaccaccaacgccgcaggccgaggcccggcctggtcgaactcactattcgag
gacaacgcggagttcgggctcggactgcggttggccggcgacgcacatgtccagctggcc
cggcgacggctggccgaactgcgtgacccgctaggtgccgatctcgtcgacgccattttg
gcggcaccacagcagcgggagtcggagttggcggcacagcgggagcggctgggcgagctg
aaggaccgacttcgcggtctcgatcccgtcagcgccgctgacctgctcagcgtggtggat
cacctgatccggcgcagcgtgtggatcgtcggcggcgacggctgggcgtacgacatcggg
tccgggggactcgaccacgtgttgtcgaccgggcgcaacgtcaacgtgttggtgctcgac
accgaggtctactccaacaccggtggccagatgtccaaggcgacgccactgggcgcggtt
gccaagtttgcttccgcgggtaagacggttccgttgaaagatctcgcactgcaggcgatc
gcttacggaagcgtctacgtcgcgaaggtcgcgatgggtgccgatccgcagcagacgctg
caggccttccgcgaagccgaggcgtacgacgggccgtcgctgataatcgcctacagccag
tgcatcgcgcatggcatcgacatgcgtctcgggatggatcagcagtaccgtgccgtcgcc
agtgggcactggccgctcctgcgctacaacccggtgttgcgtgccaccggagaaaatccg
ttcctgctcgattcgcaccgaccgcggatcccgctcgacgactaccgcaagcgggaactg
cggtaccgctcactcgccaacgccgaaccggtcgaatacgagcggctgctggggatggcc
gagcagatgatcgcgcagcgctggaatgtctacgaggagatggcatcccgtggtccccaa
agcttccaacccgatgcacggagggaacactga

DBGET integrated database retrieval system