KEGG   Mycolicibacterium rhodesiae: MycrhN_0236
Entry
MycrhN_0236       CDS       T01685                                 

Definition
(GenBank) isopropylmalate/homocitrate/citramalate synthase
  KO
K01640  hydroxymethylglutaryl-CoA lyase [EC:4.1.3.4]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00072  Synthesis and degradation of ketone bodies
mrh00280  Valine, leucine and isoleucine degradation
mrh00281  Geraniol degradation
mrh00650  Butanoate metabolism
mrh01100  Metabolic pathways
mrh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MycrhN_0236
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MycrhN_0236
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MycrhN_0236
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    MycrhN_0236
Enzymes [BR:mrh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.4  hydroxymethylglutaryl-CoA lyase
     MycrhN_0236
SSDB
Motif
Pfam: HMGL-like
Other DBs
NCBI-ProteinID: AEV70879
UniProt: G8RHS7
LinkDB
Position
234802..235710
AA seq 302 aa
MTALPKHVDIRDVSLRDGLQIEDPIPLAAKLELLAAVAATGVKEMEATAFVSPSKVPALA
DAAELAAELHNFPGIEFSALVASPNGAKRAIAAGLGSIEYVVSAADGHSRSNVGRSTAEA
TAQIPEIVAIAHDSGVTVEVIIATAWDCPFDGPTPPQRVLDIVAAACVNGVDRVAIADTI
GTATPRRVSDLVTLVRPQIGDIPLGAHFHNTRGAGLASAYAAVVAGITRLDASVGGLGGC
PFAPGASGNIALEDLVYLLRDSGIGTDVDLQAAIAAAGVAQTAVGHPLPSSLLRVGDRIL
GT
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaccgcactgccgaaacatgtggatatccgcgacgtctcgctgcgtgacgggctgcag
atcgaggacccgattccgttggcggccaagctcgaactgctcgccgctgtcgccgccacg
ggggtgaaggagatggaggcgacggcgttcgtctcaccgtcgaaggtgcccgcactcgcc
gacgccgcagaactggccgccgagctgcacaactttcccggcatcgaattctcggcgctg
gtggccagtcccaacggcgccaagcgcgcgatcgccgcgggtctgggttcgatcgagtac
gtggtgtccgccgccgacggccacagccgctccaacgtcggccggtccaccgcggaagcc
accgcgcagatccccgagatcgtcgcgatcgctcacgacagcggcgtcaccgtcgaggtc
atcatcgccaccgcgtgggactgcccgttcgacggcccgaccccgccgcagcgtgtgctg
gacatcgtggcggccgcctgcgtcaacggcgttgaccgcgtcgcgatcgccgacaccatc
ggcaccgccactccgcggcgcgtcagcgatctggtcacgctcgtgcggccgcagatcggc
gacatcccgttgggcgcacacttccacaacacccgcggggcgggtctggccagcgcgtac
gccgcggtcgtcgccggtatcacccggctggacgcgtcggtcggcggactcggcgggtgc
ccgttcgcgcctggcgccagcggcaacatcgccttggaggacctggtctatctcctgcgg
gacagcgggattggaaccgacgtcgacctgcaggcggccatcgccgcagccggcgtcgcg
cagactgccgtcgggcaccccctgccgagctctctgctgcgcgtcggcgaccggattctc
ggcacgtag

DBGET integrated database retrieval system