KEGG   Mycobacterium rhodesiae: MycrhN_0591Help
Entry
MycrhN_0591       CDS       T01685                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00473  D-Alanine metabolism
mrh01100  Metabolic pathways
mrh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    MycrhN_0591
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    MycrhN_0591
Enzymes [BR:mrh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     MycrhN_0591
Peptidoglycan biosynthesis and degradation proteins [BR:mrh01011]
 Precursor biosynthesis
  Racemase
   MycrhN_0591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AEV71229
UniProt: G8RN97
LinkDB All DBs
Position
complement(611000..612169)
Genome map
AA seq 389 aa AA seqDB search
MTMQSTRATTPATAAPPSPEAVVDLDAVAHNVRLLRERAGLAQVMAVVKADGYGHGATQT
GRAALAAGAAELGVATVDEAIRLRRDGITAPVLAWLHPPGTDFAPALEADVQIAVSSVRQ
IGELRDAAERTGRTAKVTVKVDTGLNRNGASRAEYTAMLPELKRALAEEAFTLRGLMSHL
VHGDLPDDPLNDLQAQRLREMHGQARDQGLRYEVVHLSNSPSLLTRPDLGFDMVRPGIAV
YGQTPIPERGDMGLKPAMTLKCPVALVRPVQAGEGVSYGHTWISDRDTTLALLPIGYADG
VFRNLSGRIDVLINGRLRPAVGRVCMDQLVVDVGSDGDVREGDDAILFGPGTDGEPTAQD
WAELLGTITYEVVTSPRGRVVRTYRGTPH
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgacgatgcaatcgaccagagcgaccacaccggcgacggccgcaccgccgtcccctgag
gcggtcgtcgacctcgacgccgtggcccacaacgtgaggctgctgcgggagcgcgcaggc
ctggcgcaggtgatggccgtcgtcaaggcggacgggtacggccacggtgcgacgcagacc
ggccgcgcggcgctggctgcaggcgccgcggagctgggtgtcgccaccgtcgacgaggcg
atcaggctccggcgcgacggcatcaccgctcccgtgctggcgtggctgcatccgccgggg
accgacttcgcccccgcgctcgaagccgatgtgcagatcgcggtgtcgtcggtgcgccag
atcggtgaactgcgcgacgcggccgagcggacgggacgcaccgcgaaagtcaccgtcaag
gtcgacacgggcctgaatcgcaatggcgccagccgtgcggagtacacggcgatgctgccc
gaactgaagcgcgcgctggccgaggaagcgttcacgttgcgtggcctcatgtcgcatctg
gtgcacggcgacctacccgacgatccgctcaatgaccttcaggcgcaacggctcagggag
atgcacgggcaggcgcgcgaccagggtctgcggtacgaggtggtgcatctgagcaactcg
ccctcgctgctgacacggccggatctcgggttcgacatggtccgccccggcatcgccgtg
tacgggcagaccccgatacccgaacgtggcgacatggggttgaaaccggcgatgacactg
aaatgtccggtggccctggtgcgcccggtgcaagcgggcgagggtgtgtcctatggccac
acatggatctccgatcgcgacaccaccctggcgctgctgccgatcggctatgccgacggt
gtcttccgcaacctcagcggccgcatcgacgtgctgatcaacggcagactgcggcccgcg
gtcggacgcgtttgcatggatcaactcgtcgtcgacgtgggctccgacggcgatgtgcgt
gagggtgatgacgcgatcctgttcggaccgggcaccgacggtgaacccaccgcgcaggac
tgggcggaactgctcggcaccatcacctacgaagtcgtcacgagcccacgcggccgcgtc
gtacggacctaccggggaaccccacattga

DBGET integrated database retrieval system