KEGG   Mycolicibacterium rhodesiae: MycrhN_1175
Entry
MycrhN_1175       CDS       T01685                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K00074  3-hydroxybutyryl-CoA dehydrogenase [EC:1.1.1.157]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00360  Phenylalanine metabolism
mrh00362  Benzoate degradation
mrh00650  Butanoate metabolism
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
mrh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MycrhN_1175
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MycrhN_1175
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MycrhN_1175
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.157  3-hydroxybutyryl-CoA dehydrogenase
     MycrhN_1175
SSDB
Motif
Pfam: 3HCDH_N 3HCDH F420_oxidored NAD_binding_2 2-Hacid_dh_C Shikimate_DH NAD_Gly3P_dh_N NAD_binding_7 Sacchrp_dh_NADP TrkA_N NAD_binding_8 Pyr_redox_2 Pyr_redox
Other DBs
NCBI-ProteinID: AEV71798
UniProt: G8RW57
LinkDB
Position
complement(1192178..1193032)
AA seq 284 aa
MSIERVGVIGAGQMGSGIAEVSAKAGAEVVVYEPSEELVEAGRKRLTGSLERAAAKGKLS
EGDRDAALARLKFTTDLGELADRQLVIEAVVEDETVKAKIFAELDRIVTDQDAVLASNTS
SIPIMKIAAATQNPSRVLGLHFFNPVPVLPLVELINTLVTSDEAIARTEQFASEVLGKKV
VRCGDRSGFVVNALLVPYLLSAIRMAEAGVAGVEDIDTAIVAGLSHPMGPLRLSDLIGLD
TMKLIADSMYDEYKDPNYAPPPLLLRMVEAGRLGKKSGQGFYTY
NT seq 855 nt   +upstreamnt  +downstreamnt
gtgagtattgagcgggtgggtgtcatcggcgccggacagatgggttcgggcatcgccgag
gtgagcgccaaggccggcgccgaagtcgtcgtctacgagccgtccgaggagctggtcgag
gcgggccgcaagcggctcactggttcgctcgagcgcgcggccgccaagggcaaactgagc
gagggcgatcgcgacgccgcgctggcgcggctgaagttcaccaccgacctcggtgaactc
gccgaccggcagctggtcatcgaggcggtggtcgaggatgagaccgtcaaagccaagatc
ttcgccgagctcgacaggatcgtcacggatcaggatgcggtgctggcgtcgaacacgtcg
agcatcccgatcatgaaaatcgctgcggcaacgcagaatccgagccgtgtgctggggctg
cacttcttcaacccggtgccggtcctgccgctcgtcgaactgatcaacacgctggtcacc
tccgacgaggcgatcgcgcggaccgagcagttcgcgagcgaggtgctcggcaagaaggtg
gtgcgctgcggcgatcgctcgggtttcgtcgtcaacgcgctgctggtgccgtatctgttg
tcggccatccggatggccgaagcgggcgtcgcaggagtcgaggacatcgacaccgccatc
gtggccgggctctcgcatccgatgggcccgctgcggctgtccgacctgatcggcctcgac
acgatgaagctgatcgccgactcgatgtacgacgagtacaaggacccgaactacgccccg
ccgcctctgctgttgcgcatggtcgaagccggtcgattgggcaagaagtcgggccagggt
ttctacacgtactga

DBGET integrated database retrieval system