KEGG   Mycolicibacterium rhodesiae: MycrhN_1388Help
Entry
MycrhN_1388       CDS       T01685                                 

Definition
(GenBank) protein kinase family protein
Organism
mrh  Mycolicibacterium rhodesiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Kdo Pkinase_fungal Haspin_kinase RIO1
Motif
Other DBs
NCBI-ProteinID: AEV72005
UniProt: G8RYB4
LinkDB All DBs
Position
complement(1414740..1416896)
Genome map
AA seq 718 aa AA seqDB search
MEGTPFGRYRLVELIGRGGMGDVWRAFDTVTDRVVAVKVLPAHLANDQTFQERFRREARA
AAGLNNPHVVPIHDFGEIDGRLFVDMRLIEGEDLGTLLASGPLPPRRAIKIIEQIALALF
AAHRIGLVHRDVKPSNILVTEDDFAYLIDFGIARAAGEAGLTDTGAAVGTWAYMAPERFS
TGAADARADVYALTCVLYEALTGESPFPAKTLEQIATAHMLQPPPQPSTVRPQVPRAMDE
VITTGMAKEPEQRYASTKDLATAARAAVGGATDHTQAAPPLWTSQPTQQVHRPGPTVAGP
PADPTERLRQPDPAAFAAATQYRTPTDQVPPRPAEPPAPAAPPSGRRRNILLAAGAAVVV
VIVAVVAVIAFTGDSDSPSGGSASSGSSPSGSSSPGAPPSVPQAAPAGAMFNGTQPWTVD
VSGAAKSDRSDAIIGALNAAGGWGTENRLQIDFSNAVFFADQNTPRMQVVGTEDYCGGGP
DCDAVPAEMPVPDNANIGGSTDLQCDPSGNTEGQGDCQLLVVDRDGQKLYETYHSTKEGD
ALKAQAFFIWDLNKEYPENLRGDQCTSADAGGFPIAAMTPTADEVASGSIDHAIRFILPN
DRMRAEVYVHPASHAGGPESTDDNAPPYGVRFRLKADFDDSGYTDSQKVVITALKTHGML
LADGGQVPLTFADDRTSTAKWADLGIASDTFSAITPDAFEVVELGPDVPLTYDCVRNP
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
gtggagggcacgccgttcgggcgctatcgactggtcgagttgattggtcggggtggaatg
ggcgacgtctggcgcgccttcgatacggtgaccgaccgcgtggtggcggtgaaagtcctg
cccgctcacttggccaacgatcagacgttccaggaacgattccgccgggaggcacgggcg
gcggcggggctgaacaacccccacgtggtgccgatccacgacttcggtgagatcgacggt
cgtctgttcgtggacatgcggctcatcgagggtgaagacctcggcacactgctcgcgtcc
ggtccgctacctccgcgacgcgccatcaagatcatcgagcagatcgcgctcgcgctgttc
gccgctcaccgcatcggtctggtgcaccgcgacgtcaagccgtcgaacattctcgtcacc
gaggacgacttcgcctatctgatcgacttcggcatcgcgcgtgcggcaggcgaagccggg
ctcaccgacacgggagccgcggtagggacctgggcctacatggcgccggagcgcttctcg
accggcgcggcggatgcgcgcgccgacgtatatgcgctcacctgcgtgctgtacgaagcg
ctgaccggtgaatcaccctttcccgcaaagactctcgagcagatcgccaccgcgcacatg
ctccagccgcctccgcagccatcgacggtgcggccgcaggtcccgcgggcgatggatgag
gtcatcacgaccggcatggccaaggaacccgaacagcgctacgcctcgacgaaagacctc
gcaaccgcggcccgggcagcggtcggcggcgcgacggatcacacccaggccgcaccgccg
ctgtggacgtcgcagcccacccagcaggtgcaccgccccggtccgaccgtggcgggcccg
cccgcggaccccactgaacggcttcgccagcccgaccccgcggcattcgccgccgcgacg
cagtaccggacgccgaccgatcaggtaccgccccggccggccgagccacccgcacctgcg
gccccgccgtcgggtcggcgcaggaacatcctgctggccgcgggcgccgcggtcgtcgtg
gtgatcgtggcggtggtcgccgtcatcgcgttcaccggtgactccgactcgccatcgggc
ggcagcgcatcgtcggggtcgtcgccgtcggggtcgtcgtcaccgggggcgccgccgtcc
gtaccgcaggccgcgcccgccggtgcgatgttcaacgggacccagccctggaccgtcgac
gtctccggtgcggcgaagtccgaccgcagcgacgcgatcatcggtgcgctcaacgctgcg
ggcggttggggtacggagaacagactgcagatcgacttctccaacgcggtcttcttcgcc
gatcagaacacgcctcggatgcaggtcgtcggcaccgaagactactgcggcggcggtccg
gactgcgatgctgtgcccgcggagatgccggtgccggataacgccaacatcggtggatcg
acggatcttcaatgcgacccgtcgggcaacaccgagggtcagggtgactgtcaactgctc
gtcgtcgaccgcgacggtcagaagctgtacgagacataccattcgacgaaggagggggac
gccctcaaggcgcaggccttcttcatctgggacctgaacaaggagtacccggagaacctg
cgaggcgaccagtgcaccagcgcggatgccgggggcttcccgatcgccgccatgacaccg
acggccgacgaagtcgcctcgggctcaatcgatcatgcgatccggttcatcctgcccaac
gaccggatgcgggcagaggtctacgtgcatcccgccagccacgcaggcggcccggaaagc
accgatgacaatgcgccgccatacggtgtgcgtttccggctcaaggccgacttcgacgac
tcgggttacaccgactcgcagaaggtggtgatcacggccctgaagacccacgggatgctg
ctggccgacggtggccaggtaccgctcacgttcgccgacgacaggaccagcaccgccaag
tgggcggatctgggcatcgcctcggataccttcagcgcgatcacccccgatgcgttcgag
gtggtcgaactcgggccggacgtgccgctgacctacgactgcgtccgcaacccctag

DBGET integrated database retrieval system