KEGG   Mycolicibacterium rhodesiae: MycrhN_2046Help
Entry
MycrhN_2046       CDS       T01685                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
mrh  Mycolicibacterium rhodesiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AEV72647
UniProt: G8RQP6
LinkDB All DBs
Position
complement(2076594..2077667)
Genome map
AA seq 357 aa AA seqDB search
MKLPVMPPVSPMLAKSVPTIPSGASYEPKWDGFRSICFRDGDEVELGSRNERPLTRYFPE
LVAAVTAELPERCVIDGEIIIATNHELDFEALQQRIHPADSRVRMLAKQTPASFVAFDLL
ALGDDDYTGKPFTERRAALVTALADSGPSVHLTPATTDLTTAHRWFEEFEGAGLDGVVAK
PLTATYQPDKRVMFKIKHQRTADCVIAGYRVHKASQDAIGSLLLGLYTDDGTLASVGVIG
AFPMTKRRQLFTEMQPLITAFDDHPWNWAAHEAGDRTPRKNESSRWNAGKDLSFVPLRPE
RVVEVRYDHTEGDRFRHTAQFNRWRPDRDPRSCTYAQLEQPVVFRLDDIIPGLGSRA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttcccgtcatgccgccggtctcgccaatgctggccaagtcggtgccgacaatc
ccctctggtgcctcctatgaaccgaagtgggacggcttccgatcgatctgcttccgcgac
ggcgacgaagtcgaactgggtagccgcaacgagcggcccctgacacggtacttccccgaa
ctggtcgccgccgtcaccgccgaactgcccgagcgttgcgtgatcgacggcgagatcatc
atcgccaccaaccacgagctggatttcgaagcactgcaacaacgcatccaccccgccgat
tcgcgagtacggatgctcgccaagcagacccctgcgtccttcgtagcgttcgatctactc
gccttgggcgacgatgactacaccgggaaaccgttcaccgagcggcgcgccgcactcgtc
acggccttggccgactccgggccctcggttcacctaactcctgcgacgacggatctcacg
acggcgcatcggtggttcgaagagttcgagggggcgggtctcgatggcgtcgtcgccaag
cccctgacggccacctatcaacccgacaagcgggtcatgttcaagatcaagcaccagcgg
accgccgactgcgtcatcgccggttaccgggtgcacaaggccagccaggacgcgatcggc
tccctgctgctcgggctctacaccgacgacggcaccctcgcctccgtcggcgtgatcggc
gcgttcccgatgaccaagcgccgccagctgttcaccgaaatgcagccgctgataaccgca
ttcgatgaccatccgtggaactgggccgcccacgaagccggtgaccgcacaccccgcaag
aacgaaagctcccgctggaacgccggcaaggatctctcgttcgtcccgctgcgacccgag
agggtcgtcgaggtccgctacgaccacacggaaggcgaccggttccgccacactgcgcaa
ttcaaccgctggcggcccgaccgcgacccacgctcgtgcacctacgcccaactcgaacaa
ccagttgtcttccggctcgacgacatcatccccggcctcggctcaagggcctaa

DBGET integrated database retrieval system