KEGG   Mycobacterium rhodesiae: MycrhN_2049Help
Entry
MycrhN_2049       CDS       T01685                                 

Definition
(GenBank) ATP dependent DNA ligase-like protein,ATP dependent DNA ligase family protein
Organism
mrh  Mycobacterium rhodesiae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AEV72650
UniProt: G8RQP9
LinkDB All DBs
Position
2081218..2082378
Genome map
AA seq 386 aa AA seqDB search
MSGLQSDAASSRRYDVAPGCSASGKITRHGNPLGADSTRPTSPIAGSSARRSHSIGRLAE
VQSTRRALVFRDGDQILLLSRSGKDLGRYFPELLDALRDELASRCVLDGEVVVPREIDGR
VRLDWESLSQRIHPAASRIKLLAEQTPAHFIGFDALATGDASLLSEPFRVRRKALSDAVN
EKTWCHVTRTTEDPEQGAQWLDTFEGAGLDGVIAKRLDGHYLPGKRDMVKVKHARDADCV
AIGYRVHKSGEGVGSILLGLYRDDGELQMVGGAASFSVKARIKLLADLEPLREGDQVNDG
EPSRWNSAADKRWIPVRPEKVCEVAYDQMEGNTVAGAGGPATSGASKRFRHAVKFIRWRP
DREPSSCTFDQLDVPLNYDLYDVLEP
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
gtgagtggactgcaatcagacgccgccagttcgcgaaggtatgacgtcgccccgggatgc
tcggcatcggggaagatcacccgccacggcaacccgctcggcgccgactccacccgaccc
acctcgcccatagccggatcctccgcccgccgcagccactccatcggaaggctcgccgaa
gttcagtcaactagacgggcgctggtattccgcgacggcgaccagattctgctgctgtcg
cgcagcggcaaagacctcggcagatacttcccggagctgctcgacgcccttcgcgacgag
ttggcatcgcggtgcgtgctcgacggcgaggtcgtcgtgccgcgcgagatcgacggacgt
gtccggctggactgggagtcgctgtcgcaacgcatccatccggcggccagccggatcaag
ctcttggccgagcagacgccggcgcacttcatcggattcgacgcgctcgccaccggcgac
gcgtcgctgctctccgagccgttccgggtccgccggaaggccttgtcggacgcggtgaac
gagaagacctggtgtcacgtcacccgaacaaccgaggatcccgagcagggggcgcaatgg
cttgacaccttcgagggcgccggcctggacggcgtgatcgccaagcggctcgacgggcac
tacctgcccggtaagcgggatatggtgaaggtcaaacatgcccgcgatgccgactgtgtg
gccatcgggtatcgcgtccacaagagcggcgaaggcgtcggatcaatcttgctcggcctg
tatcgcgacgacggcgaactccagatggtcggtggcgcagcatcattcagcgtaaaggcg
cgcataaagttgctggccgacctggagccgctacgtgagggtgaccaagtcaacgacggc
gagcccagccggtggaactcggctgccgacaagcgctggattccggtgcgcccggagaag
gtctgcgaggtcgcctacgaccagatggaagggaacacggtggccggagccggagggccg
gcgacatcaggggcgagcaagcgcttccggcatgcggtcaaattcatccgctggcggccc
gaccgtgagccgtccagttgcaccttcgatcagctcgacgttcccctgaattacgatctc
tacgacgtgctggagccctga

DBGET integrated database retrieval system