KEGG   Mycolicibacterium rhodesiae: MycrhN_2254
Entry
MycrhN_2254       CDS       T01685                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K00019  3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00072  Synthesis and degradation of ketone bodies
mrh00650  Butanoate metabolism
mrh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MycrhN_2254
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    MycrhN_2254
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     MycrhN_2254
SSDB
Motif
Pfam: adh_short_C2 adh_short Sacchrp_dh_NADP Epimerase KR NAD_binding_10 AdoHcyase_NAD Shikimate_DH
Other DBs
NCBI-ProteinID: AEV72844
UniProt: G8RT32
LinkDB
Position
2279744..2280490
AA seq 248 aa
MTELAGRTALVTGGASGIGEACARELAARGAVVTVADRDDVGAKSVAEDIGGKAWAVDLS
DVSALEGLALDTDILVNNAGVQHVSPIPDFAPDRFRHLMTLMVESPFLLIRAALPHMYEL
NFGRIINISSVHGLRASEYKAAYVTAKHGLEGLSKVTALEGAPHGVTSNCVNPGYVRTPL
VTKQIADQAKVHDVPEDKVVTDILLKESAIKRLVEPEEIGALVGWLASPMAGMVTGASYT
MDGGWSAR
NT seq 747 nt   +upstreamnt  +downstreamnt
atgaccgaactcgcggggcgcacagcgctcgtcaccggcggcgcgagcggtatcggcgag
gcgtgcgcacgggaactggctgcgcggggagcggtcgtgaccgtggcggaccgcgacgat
gtcggcgcgaagtctgtcgccgaggacatcggcggaaaagcctgggccgttgacctttcc
gacgtctcggcgctcgaaggcctcgcactcgacactgacatcctggtcaacaacgcaggc
gtgcaacacgtcagtccgatccccgacttcgcaccggatcgctttcgccatctgatgacg
ctcatggtggaatcgccgttcctgctcatccgcgccgcattgccgcacatgtacgaacta
aacttcgggcggatcatcaacatctcctctgtgcacgggctcagggcatcggagtacaag
gccgcctacgtcaccgccaaacacggactcgagggcctgtcgaaggtcaccgctctcgag
ggtgcgccgcacggggtgacgagcaattgcgtgaatcccgggtatgtgcgaaccccactg
gttaccaagcagatcgccgatcaggccaaggtgcacgacgtcccggaggataaggtggtg
accgacatcctcctgaaggagagcgccatcaaacgtctggtggaacccgaggaaataggg
gccctcgtgggctggctggcgtcgccgatggcgggcatggtgaccggcgcgtcgtacacc
atggacgggggttggagcgcgcgatga

DBGET integrated database retrieval system