KEGG   Mycolicibacterium rhodesiae: MycrhN_2255
Entry
MycrhN_2255       CDS       T01685                                 

Definition
(GenBank) acetoacetyl-CoA synthase
  KO
K01907  acetoacetyl-CoA synthetase [EC:6.2.1.16]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00280  Valine, leucine and isoleucine degradation
mrh00650  Butanoate metabolism
mrh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MycrhN_2255
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MycrhN_2255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mrh01004]
    MycrhN_2255
Enzymes [BR:mrh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.16  acetoacetate---CoA ligase
     MycrhN_2255
Lipid biosynthesis proteins [BR:mrh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MycrhN_2255
SSDB
Motif
Pfam: AMP-binding ACAS_N AMP-binding_C
Other DBs
NCBI-ProteinID: AEV72845
UniProt: G8RT33
LinkDB
Position
2280487..2282382
AA seq 631 aa
MSDVAPQWVPTAEDVANARVTDFARFVADRAGVTTTDYASLWQWSVDEPATFWATLWDYF
ELGERGDKVLENQTMPGAQWFPGVRLNYVDQVIRNVRTDRPAIIHVAEDGTDVEISWAEL
LGRSALFAERLRSLGVGVGDRVAGYLPNIPEAVIAFLATASVGAIWSACGQDYSANAALD
RLGQLEPVVLVTADGYDFGGKHYDKREDAEALRAGLPTVKATVLASELTASGGELTTVPV
DFDHPLWILYSSGTTGKPKGIVHGHGGVVLEHLKAVALQSDIGPEDTFFWYTSPSWMMWN
FQVAGLLVGATIVCYSGSPNAPKPDALWDIASRLRATVLGTSPGYVLGCAKAGAVPRKDH
DLSALRTVGITGSSLPPSSSLWLRDNVGEHVQVASISGGTDVVSAFIGGVRTVPVWPGEL
SAPFLGCALDAWDESGKPVRGEVGELVITKPMPSMPIGFWNDDDGSRYRSAYFEMFPGVW
RHGDWITITDHGSVIVHGRSDSTLNRHGIRMGSADIYQSVERLPEITEALVIGCEQPDGG
YWMPLFVVLAEGAELTDQLRDRIKKTIRDEVSPRHVPDDIIEAPGVPHTRTGKKLEVPIK
KLFAGADASKVVERTAVDDPDLLDWYATLKR
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgagcgatgttgcaccgcaatgggtgccgacggctgaggacgtcgccaatgcccgagtg
accgacttcgcgcgcttcgtcgctgaccgcgcgggcgtgacgaccaccgactatgcatcg
ctgtggcagtggtcggtggatgagccggccacgttctgggcgacgttatgggactacttc
gagctcggcgaacgcggtgacaaggtcctcgagaaccagacgatgccgggggcgcagtgg
tttcccggtgtcaggctgaactacgtcgatcaggtcatccgcaacgtgcgcaccgaccgc
cccgcgatcatccatgtcgccgaggacggcaccgacgtcgaaatctcttgggctgaatta
ctcggacgcagtgcgctgttcgcggagaggctgcgttcgctcggggttggtgtgggggat
cgggtcgcaggatatctgccgaacatccccgaagccgtcatcgcgttcctggcgacagcg
agcgtcggcgcgatctggagtgcctgcggccaggactattcggccaacgccgcgctggac
cggttgggtcagctcgagccggtcgtgctggtgacggcggacggttatgacttcggcggc
aagcactacgacaagcgcgaggatgccgaggccctgcgcgcgggactgccgacggtgaag
gccacggtgctggcgtccgaactcaccgcaagcggcggcgagctgactacggtgcccgtc
gatttcgaccacccactgtggatcctgtactcgtcaggaacgacgggtaagcccaagggt
atcgtgcacggtcacggcggtgtcgtgctcgaacacttgaaagccgttgccctacagtcg
gatatcggacccgaggatacgttcttctggtacaccagcccaagctggatgatgtggaac
ttccaggtcgccggccttttggtgggcgcgaccatcgtctgctactcgggcagcccgaat
gcaccgaaaccggatgccttgtgggacatcgcttcccgattgcgcgcgaccgtactgggt
accagtccggggtatgtgctcggatgcgcgaaagcaggtgcggtgccgcgcaaagaccat
gacctgtcggcgctgagaacggtcggcatcaccggatcgtccctgccgccgtcatcgtcg
ctgtggctgcgcgacaacgtcggtgagcacgtgcaggtggcgtcgatcagcggcggcacc
gacgtcgtgtcggccttcatcggcggtgtgcgcaccgtcccggtgtggccaggcgagttg
tctgccccgttcctgggctgcgcgctcgacgcctgggacgagtcggggaagccggtgcgc
ggcgaggtaggcgagttggtgatcaccaagccgatgccgtcgatgccgatcggtttctgg
aacgatgacgacgggtcgcgttaccgcagtgcgtatttcgagatgttccccggcgtgtgg
cggcacggagactggatcaccatcaccgaccacggaagcgtcatcgtgcacggccgttcg
gactcgacgctgaaccggcacggtatccggatgggcagcgccgacatctaccagtcggtg
gagcggctgccggagatcaccgaggcgttggtcatcggatgcgagcaacccgacggcgga
tattggatgccgttgttcgtcgtccttgcggagggcgccgagctgactgaccagctgcgc
gaccggatcaagaagacaatccgcgacgaggtgtccccgcgtcatgttcccgacgacatc
atcgaggctcccggcgtgccacacacccgcacgggtaagaagctcgaagtgccgatcaag
aagcttttcgccggcgcggacgcctcgaaggttgtggagcgcaccgccgtcgacgacccc
gacctgctggactggtacgccacgctgaagcgctag

DBGET integrated database retrieval system