KEGG   Mycolicibacterium rhodesiae: MycrhN_2295
Entry
MycrhN_2295       CDS       T01685                                 

Definition
(GenBank) acetaldehyde dehydrogenase (acetylating)
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00360  Phenylalanine metabolism
mrh00362  Benzoate degradation
mrh00620  Pyruvate metabolism
mrh00621  Dioxin degradation
mrh00622  Xylene degradation
mrh00650  Butanoate metabolism
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
mrh01220  Degradation of aromatic compounds
Module
mrh_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    MycrhN_2295
   00650 Butanoate metabolism
    MycrhN_2295
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    MycrhN_2295
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MycrhN_2295
   00622 Xylene degradation
    MycrhN_2295
   00621 Dioxin degradation
    MycrhN_2295
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     MycrhN_2295
SSDB
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh GFO_IDH_MocA NAD_binding_3
Other DBs
NCBI-ProteinID: AEV72885
UniProt: G8RU42
LinkDB
Position
2323985..2324905
AA seq 306 aa
MPQKSSVAIVGSGNISTDLLYKLLRSEWLEPRWMIGIDPASEGLARARKLGLETSHEGVD
WLLAQSEKPDLVFEATSAYVHRDAAPRYAEAGIRAIDLTPAAVGPGVIPPANLRAHLDAP
NVNMVTCGGQATIPMVYAVSRVVDVPYAEIVASVASASAGPGTRANIDEFTKTTSAGVEV
IGGAKRGKAIIILNPADPPMIMRDTIFCAIPEDADHDAITQSIKDVVAEVQTYVPGYRLL
NEPQFDEPSIVNGGNHVVTTFVEVEGAGDYLPPYAGNLDIMTAAATKVGEEIAKESLSAT
AGGGQA
NT seq 921 nt   +upstreamnt  +downstreamnt
atgccgcagaaatcttctgtcgcgatcgtcgggtccggaaacatcagcaccgacctgctg
tacaaactgttgcgctcggagtggctcgagccgcgctggatgatcggcatcgatcccgcg
agcgaaggcctcgcccgtgcacgcaaactcggcctggagacgtcgcatgagggtgtcgac
tggctgctggcccagagcgaaaagccggaccttgtcttcgaggccaccagcgcctatgtg
caccgtgacgccgcgccgcgatacgccgaggccggtatccgcgccatcgacctgaccccc
gcagccgtcgggcccggcgtcatcccgcccgccaatctgcgcgcccacctcgatgcgccg
aacgtcaacatggtcacctgcggcggtcaggccaccatcccgatggtgtacgccgtgtcg
cgcgtcgtggatgtgccctacgccgagatcgtggcatcggtggcgtcggcgtcggcgggt
cccggaacgcgagccaacatcgatgagttcaccaagaccaccagtgcgggcgtggaggtc
atcggcggcgccaagcggggcaaggcgatcatcatcctgaatcccgccgatccgccgatg
atcatgcgcgacacgattttctgcgcgatccccgaggacgccgatcacgacgcgatcacc
cagtcgatcaaggacgtagtagccgaggttcagacctacgtacccggctatcgcctgctc
aacgagccacaattcgacgaaccgtcgatcgtcaacggtggaaaccacgtcgtcaccaca
ttcgtggaagtggagggtgcgggcgactacctgccgccctacgctggaaacctggacatc
atgacagccgcggccaccaaggtcggcgaggagatcgcaaaggaaagcctttccgcgact
gccggaggaggccaagcatga

DBGET integrated database retrieval system