KEGG   Mycolicibacterium rhodesiae: MycrhN_3142
Entry
MycrhN_3142       CDS       T01685                                 

Definition
(GenBank) ring-hydroxylating dioxygenase, large terminal subunit
  KO
K18251  phthalate 3,4-dioxygenase subunit alpha [EC:1.14.12.-]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00624  Polycyclic aromatic hydrocarbon degradation
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
mrh01220  Degradation of aromatic compounds
Module
mrh_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MycrhN_3142
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     MycrhN_3142
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AEV73675
UniProt: G8RMK8
LinkDB
Position
3151271..3152725
AA seq 484 aa
MQDHGEVLAAVRTGMIPAHVYNDKQIFSLEKERLFSRAWLFVAHESEIPQPGDYVVRQVL
QDSFIVARDSAGEVRVMFNMCLHRGMQICRAEMGNASNFRCPYHGWSYRNDGRIIGLPFH
QEAYGGDAGFNKTGQTLLPAPSVASYNGLIFLSMDPDAESLEDYLGDFRFYLDFYTKQGP
NGLEVQGPQRWRVKANWKIAAENFAGDMYHTPQTHTSVVEIGLFREPKAHKRKDGATYWA
GRGGGTTYKLPEGSFEDRMSYVGYPAEMISRAKATWTEQQRQVVGADGFMISAATCFPNI
SFVHNWPKVEDGEHVLPFISIRVWQPISENETEVLSWFAVDSDAPEAFKAASYKAYLMCF
GSTGMFEQDDVENWVSLTNTAGGSMARRLRLNSRMGLLADDARVVDTLSSAQFHGPGYAQ
LGYNENNQRELLRLWADYLDMPPLRVDPATVLTDNPQGIEPMVQTNGRAVAGIDSESATT
SVTL
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgcaggatcacggtgaggtgttggcggcagtacgcactggcatgattccggcgcacgtg
tacaacgacaagcagattttctcgctcgaaaaggagcggctgttcagtcgggcgtggttg
ttcgtcgcgcacgagtccgaaattccgcagccgggcgactacgtggtcaggcaagtgtta
caggactcgttcatcgtcgctcgtgattctgcaggcgaggtccgggtgatgttcaatatg
tgcctccatcgcggtatgcagatttgtcgggcggagatggggaacgcctcgaatttcaga
tgcccgtaccacgggtggtcttaccgcaacgacggccgcattatcggactgccttttcac
caagaggcctatggaggagacgcggggttcaacaagacgggtcagaccctgttgccagcg
ccgagtgtggccagctacaacgggttgatcttcctgtcgatggatcctgacgcagaatcg
cttgaagactacctgggtgatttcaggttctatctcgatttctacaccaagcagggcccc
aacggtctcgaggtgcaaggtcctcagcgttggcgggtaaaagcgaactggaaaatcgca
gctgagaatttcgccggggacatgtaccacaccccgcagacgcacacgtcggtggtcgag
atcggcctgttccgagagccgaaggcccacaagcgcaaagacggcgcaacctattgggcg
ggcagaggtgggggcaccacatacaagctgccggaggggagtttcgaagaccggatgagc
tatgtcggctacccggcggagatgatcagtcgtgccaaggcgacctggaccgagcagcag
cgacaggtcgtgggcgccgacgggttcatgatctcggcggcgacgtgctttccgaacatc
agtttcgtgcacaactggccgaaagtggaggacggcgagcacgtcttaccgttcatttcg
attcgggtatggcagcccattagcgagaacgagactgaggtgctgtcctggtttgcggtg
gattctgatgccccggaagcgtttaaggcggcctcatacaaggcttatttgatgtgtttc
ggctcgacgggaatgttcgaacaagacgatgtcgagaactgggtgtcgctgaccaacacc
gcggggggttcgatggcccgccgactgcggctgaacagccggatggggctgctcgcagac
gatgcccgggtggtcgacaccctaagcagcgctcagtttcacgggcctggatacgctcag
ctcggctacaacgagaacaatcaacgggaattattgaggctctgggctgactacctcgac
atgccgccgctgcgagtcgacccggctactgtgctcacggacaacccgcaaggtattgag
ccgatggtgcagaccaatggccgggccgtcgccggtatcgactcggagtcggctacgacg
tcggtgacgctgtga

DBGET integrated database retrieval system