KEGG   Mycolicibacterium rhodesiae: MycrhN_3143
Entry
MycrhN_3143       CDS       T01685                                 

Definition
(GenBank) small subunit of phenylpropionate dioxygenase
  KO
K18252  phthalate 3,4-dioxygenase subunit beta [EC:1.14.12.-]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00624  Polycyclic aromatic hydrocarbon degradation
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
mrh01220  Degradation of aromatic compounds
Module
mrh_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MycrhN_3143
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     MycrhN_3143
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: AEV73676
UniProt: G8RMK9
LinkDB
Position
3152755..3153318
AA seq 187 aa
MAPSVLGAHAARAQRVGEALPFDDSRHLEAHRFLVNEAYLLDAQDYDRWLGVLTEDIHYY
MPVRITTAAGAGFDTSAGMAHFDENKYSLSRRVARFATEHAWTEDPPSRLRHFITNVRTF
LTDDADYLAVDSAELLFRSRGDVNESTLLSCGREDLLRRDGNALKLARRTIAVDESVLRM
QNLAVFL
NT seq 564 nt   +upstreamnt  +downstreamnt
atggccccatcggtactcggtgcgcacgccgcccgcgcccaacgtgtgggggaagccttg
ccgttcgacgattctcgccatctggaggcgcatcgcttcctcgtcaacgaggcgtacctt
ctcgatgcccaagactacgacaggtggctgggtgttcttaccgaggacattcactattac
atgccggtgcggatcaccaccgccgccggcgccggattcgatacctcagcaggaatggcg
catttcgacgagaacaaatactcactcagtcgccgcgttgcccgattcgccaccgagcac
gcctggactgaggatccgccgtcgcgcctgcgccacttcatcaccaacgtgcgcacattc
ctcaccgacgacgccgactacctcgcggtcgacagcgctgagttgttgttccgcagccgc
ggcgacgtcaatgagtccacgctcctttcatgcggtcgtgaggatctcctacgtcgcgat
ggcaacgccctcaaactcgcccggcgcacaatcgccgtcgatgaatcagtgcttcgaatg
cagaatctggcggtattcctatga

DBGET integrated database retrieval system