KEGG   Mycolicibacterium rhodesiae: MycrhN_3146
Entry
MycrhN_3146       CDS       T01685                                 

Definition
(GenBank) ferredoxin
  KO
K18253  phthalate 3,4-dioxygenase ferredoxin component
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00624  Polycyclic aromatic hydrocarbon degradation
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
mrh01220  Degradation of aromatic compounds
Module
mrh_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MycrhN_3146
SSDB
Motif
Pfam: Fer4_15 Fer4_13 Fer4_19
Other DBs
NCBI-ProteinID: AEV73679
UniProt: G8RML2
LinkDB
Position
3154449..3154649
AA seq 66 aa
MDGVIKANHAVCQGYANCVVAAEDYFDIDDRGLVLVRKTEVPSADRTRVEEAARSCPVAA
LEVVDE
NT seq 201 nt   +upstreamnt  +downstreamnt
atggacggagtcataaaggctaaccacgcggtatgtcagggatacgcgaactgtgtcgta
gccgccgaggactacttcgacatcgacgaccggggactcgtgttggtccggaagacggag
gtcccttccgcggacaggacccgggtcgaggaggctgcgcgcagctgtccggtggcagcg
ttggaagtcgtagacgaatga

DBGET integrated database retrieval system