KEGG   Mycolicibacterium rhodesiae: MycrhN_3147
Entry
MycrhN_3147       CDS       T01685                                 

Definition
(GenBank) NAD(FAD)-dependent dehydrogenase
  KO
K18254  phthalate 3,4-dioxygenase ferredoxin reductase component [EC:1.18.1.3]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00624  Polycyclic aromatic hydrocarbon degradation
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
mrh01220  Degradation of aromatic compounds
Module
mrh_M00636  Phthalate degradation, phthalate => protocatechuate
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MycrhN_3147
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.18  Acting on iron-sulfur proteins as donors
   1.18.1  With NAD+ or NADP+ as acceptor
    1.18.1.3  ferredoxin---NAD+ reductase
     MycrhN_3147
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox Reductase_C 2-Hacid_dh_C AlaDh_PNT_C NAD_binding_8 DAO XdhC_C Pyr_redox_3 3HCDH_N UDPG_MGDP_dh_N NAD_binding_7 K_oxygenase Amino_oxidase GIDA TrkA_N FAD_binding_2 Lycopene_cycl
Other DBs
NCBI-ProteinID: AEV73680
UniProt: G8RML3
LinkDB
Position
3154646..3155887
AA seq 413 aa
MTSRVVIVGSSVGGVRTAQALRSEGYDGDIVLVGEETALPYDKPPLSKALLAGTSDIAAA
TLLTRDAAAADAIELRLGRRAIGVDVAACEVEFADDEPLHYDHLVVATGASARPSPWGQG
PGVHVLRTLEDCLRLRADLVAGARLVVIGAGFIGAEVASTARSLGLQVTVVDPVPVPMSR
VLTEEIGGWFVDLHRDHGVHTRFGVGVENIEGERGNLEVGLTDGTVVEADTVVVGIGAVP
NDGWLMPSGLVVDDGLVCDEFCRAVTSENVYAVGDVSRWFHRARGVMMRIEHWTNAVDQA
SCVAHNISQPDDLRCYEPVEYVWSDQYDWKIQFCGQTTHLSEPLVVGDRLSDNRFTALYP
DGEQRLSGAAVVNWPRALIECRRALLAGSDLESVRGRLELLTNPPDTAATRSP
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgacgtcacgggtcgtcatcgtcggcagttctgtcggcggggtccgcacggcccaggcg
ctgcgatcggaaggctacgacggcgacatcgtcctcgtgggcgaggaaactgcactgccc
tacgacaaaccgccgctatccaaagcgttgcttgcgggtacgagtgacatcgcggctgcg
acgttactcaccagagacgctgccgccgccgacgccatcgagcttcgcctcggccgccgc
gcgatcggagtggatgtcgcagcgtgtgaggttgagttcgccgatgatgagcccctgcac
tacgaccacctggtggtggccaccggagcgagcgcgcgaccatccccgtggggccaggga
ccgggcgttcatgtgctacgcaccctagaggactgtctgcggctaagagccgacctcgtc
gccggtgcccgcctcgtggtgatcggggcaggatttatcggggccgaggtcgcgtcaacc
gcgcggtcgctgggtctgcaagtgacggttgtcgacccggtgccggtgccgatgagccgg
gtgcttaccgaagagatcggcgggtggttcgtcgatttgcatcgagaccacggagtgcac
acgcgattcggcgtcggtgtcgagaatattgagggggagcgcggtaacttggaggtcggc
ctcacggacgggaccgtcgtggaagccgacacggtggtggtgggcatcggcgccgttccg
aacgacggctggctgatgccgtcgggactggtggtcgatgacggcctggtctgcgacgag
ttctgtcgtgccgtcacgtcagaaaacgtctacgcagtcggcgacgtgtcgcgttggttt
catcgcgcccgcggcgtgatgatgcgcatcgaacactggacaaacgcggtcgaccaggcc
tcttgcgtcgcgcacaatatctcgcaacccgacgatctgcgctgctacgagcccgtcgag
tacgtatggagcgaccagtacgactggaagatccagttttgcggccaaacaactcaccta
agtgagccactcgtcgtcggagatcgattgtcggacaatcgattcacagcgctctacccc
gatggcgagcaacgtctgagcggcgccgcggtcgtgaactggcctcgagcactgatcgag
tgcaggcgtgcactgctggccggcagcgatctcgaaagtgtgcgggggaggctcgaattg
ttgacgaacccacccgacaccgccgcgacgcgatcaccatag

DBGET integrated database retrieval system