KEGG   Mycolicibacterium rhodesiae: MycrhN_3288Help
Entry
MycrhN_3288       CDS       T01685                                 

Definition
(GenBank) DNA ligase D/DNA polymerase LigD
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    MycrhN_3288
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:mrh03400]
    MycrhN_3288
Enzymes [BR:mrh01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MycrhN_3288
DNA repair and recombination proteins [BR:mrh03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     MycrhN_3288
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase DNA_primase_S
Motif
Other DBs
NCBI-ProteinID: AEV73813
UniProt: G8RNW2
LinkDB All DBs
Position
3288010..3290331
Genome map
AA seq 773 aa AA seqDB search
MVVDQFGRVKLTNPDKVLYPATELRPKAVTKQEVFDYYVRIAEVMVPHIAGRAVTRKRWP
NGVDEPSFFEKQLASSAPDWLERGSIAHKSGTTTYPIINSAEGLAWIAQQASLEVHVPQW
RFVSTWTRDEGAEQTPGPATRVVFDLDPGEGVTFRQLCEVAHEVRELIAGMGLTTFPLTS
GSKGLHLYVPLDEPISSRGASVLAKRVAQQLEQAMPKRVTATMTKSLRAGKVFLDWSQNN
GNKTTIAPYSLRGRDEPTVAAPRTWDEIEDPELRHLRFDEVLERVERDGDLLAQMDTDAP
VADALTTYRSMRDAGKTPEPVPHVAPTPGNDDFFVIQEHHARRLHYDFRLERNGVLVSWA
VPKNLPDTPSVNHLAVHTEDHPFEYGSFEGEIPKGEYGGGKVVIWDTGTYETEKFRDHAP
DGPAKGGEVIITLHGKKIDGRYALIQTDGKNWLAHRMKEQANPQASDLAPMLSTEGSIAK
LTSAQWAFEGKWDGYRVLVDANHGKLNVRSRRGRDVTGEYPQFASLAADLADHHVILDGE
AVALDKHGVPSFSEMQNRARSTRVEFWAFDILYLDGRSLLKAKYSDRRRLLEALADGGNL
IVPDPLPGDGPEALEHAREHRWEGVVAKKLDATYQPGRRSKSWIKDKIWNTQEVVIGGWR
KGDGGRSSGIGALMLGIPSPDNPEGGLQFVGRVGTGFTEKELSKLKGILEPLATEESPFN
ARLSTIDARGVTFVRPELVGEVRYSERTSDDRLRQPSWRGLRPDKEPSEIVWE
NT seq 2322 nt NT seq  +upstreamnt  +downstreamnt
gtggtggtggatcagttcggtcgggtgaaactgaccaacccggataaggtgctgtaccca
gcgacggaattgcggccgaaggccgtcacgaaacaagaagtcttcgactactacgtccgc
atcgccgaggtgatggtgccccacatcgcgggccgagcggtcacccgtaaacgctggccc
aacggtgttgacgagccatcgttcttcgagaagcagttggcctcgtcggcacccgactgg
ctcgagcggggctcgatcgcgcacaagtcggggaccaccacatatccgatcatcaatagc
gccgagggactggcgtggattgcgcagcaggcgtcattggaagtgcacgtgccgcagtgg
cgattcgtcagcacatggaccagagacgaaggagccgaacagacgccggggccggccaca
cgggtggtgttcgacctggatcccggtgaaggcgtgacattccggcagctgtgcgaggtc
gctcacgaggtacgtgaactgatcgccggcatgggactgactaccttcccactgaccagc
gggagcaaggggctgcacctgtatgtgccactggacgagccgatcagttcgcgaggcgcg
tcggtgctcgcgaaacgggtggcgcagcagctggagcaggcgatgcccaaacgggtcacc
gcgacgatgacgaaaagccttcgcgcaggcaaggtgttcctggactggagccagaacaac
gggaacaagaccacgatcgcgccgtattcgctgcggggccgggacgagccgaccgtcgcc
gcgccccgcacctgggatgagatcgaggatcccgagctgcggcaccttcgcttcgacgag
gtgctggaacgcgttgaacgcgacggtgacctgctggctcagatggacaccgacgccccc
gtggctgacgcgctcaccacctaccgcagcatgcgcgacgccggtaagacacctgagccg
gtaccgcacgtcgcgcccacgccgggcaacgacgacttcttcgtcatccaggagcatcac
gcgcgtcggctgcactacgacttccggctggagcgcaacggcgtgctggtgtcatgggcg
gtcccgaagaacctgcccgatacaccgtcggtcaaccacctggccgtgcacaccgaggat
catccgttcgagtacggaagcttcgagggtgaaatcccgaagggcgagtacggcggcggc
aaggtggtcatctgggacaccggcacttacgagaccgagaaatttcgtgaccacgctcca
gacggtccggccaagggcggcgaagtcataatcacgttgcacggcaagaagatcgacggc
cgatacgcgctcattcagaccgacggcaagaattggctggcgcatcgtatgaaggaacag
gccaacccacaggccagcgatctggcaccgatgctctcgacggagggctcgatcgcgaag
ctgacctcggcgcagtgggcgttcgagggcaaatgggacggctaccgagtcctggtcgac
gccaatcacggcaaactcaatgtgcggtcacgccgcggccgcgatgtcaccggcgagtat
cctcagttcgcctcgctcgctgccgatctcgccgatcaccacgtcatcctcgacggcgag
gcggtggccctcgacaaacacggcgtgccgagcttctcggaaatgcagaaccgcgcgcgg
tcgacccgcgtggaattctgggcgttcgacatcctgtacctcgacgggcgctcactgctg
aaggccaagtactccgatcggcgtcgcctgctcgaggcgctggccgacggcggcaacctg
atcgtgccggatccgttgcccggcgacggccccgaagcgttggaacacgcgcgggaacat
cgctgggagggtgtggtcgcgaagaagctggatgcgacctaccagccggggcggcgatcc
aagtcgtggatcaaggacaaaatctggaacacccaggaagtggtgatcggcggctggcgc
aagggtgacggcggccggtccagcggtatcggggcgctgatgctcggtatccccagtcca
gacaatcctgagggcggcctgcagttcgtcggtcgggtgggcacggggttcacggagaag
gagctgtccaaactcaaaggcatcctcgagccgctggcgaccgaggaatcaccgttcaac
gcccgcctctccacaatcgacgccagaggcgtcaccttcgtccgcccggaattggtcggc
gaagtgcggtacagcgaacggacatccgacgatcggctgcggcaaccgagctggcgcggc
ctgcgcccggacaaggagccgtccgagatcgtgtgggagtag

DBGET integrated database retrieval system