KEGG   Mycolicibacterium rhodesiae: MycrhN_4403
Entry
MycrhN_4403       CDS       T01685                                 

Definition
(GenBank) dehydrogenase of unknown specificity, short-chain alcohol dehydrogenase like protein
  KO
K18009  meso-butanediol dehydrogenase / (S,S)-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.- 1.1.1.76 1.1.1.304]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MycrhN_4403
Enzymes [BR:mrh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.76  (S,S)-butanediol dehydrogenase
     MycrhN_4403
    1.1.1.304  diacetyl reductase [(S)-acetoin forming]
     MycrhN_4403
    1.1.1.-  
     MycrhN_4403
SSDB
Motif
Pfam: adh_short_C2 adh_short KR DFP Epimerase RmlD_sub_bind
Other DBs
NCBI-ProteinID: AEV74897
UniProt: G8RLS4
LinkDB
Position
complement(4415680..4416420)
AA seq 246 aa
MTQLSDKVALITGVSSGLGAVVAQVFAERGAKVFGIARRADEMAAVFTDVPGGKYASVDI
SSPDACRDAVAQTVDAFGRLDILVNVAGYHQMRHTTTMTDEEWDRDLAVNLNGPFYLCRA
ALPHLLETAGNIVNVTSIAGVEGEVYSAGYCAAKHGLVGLTRALAIEFTKEKIRVNAICP
GGMPTPQATEFTAPANADWDLILRIASPRGFMDPVDVAKSVAFLASDDAAAIHGAVYRVD
NGKGAG
NT seq 741 nt   +upstreamnt  +downstreamnt
atgactcagctcagcgacaaggtcgcgttgatcaccggcgtctcgtcaggattgggcgcc
gtcgtggcgcaggttttcgcggagcggggcgcgaaggtcttcggcatcgcccgcagggcc
gacgagatggcggcggtcttcaccgacgtgccgggcggcaagtacgcgtcggtggacatc
tcgtcacctgacgcctgccgcgacgccgtcgcgcagaccgtcgatgcgttcgggcgcctc
gacatcctggtgaacgtcgcggggtaccaccagatgcgccacaccacgacgatgaccgac
gaggagtgggaccgcgatctcgcggtaaacctcaacgggccgttctacctctgccgcgcc
gcgctgccccatctgttggagaccgcgggcaacatcgtcaacgtcacgtcgatcgcgggc
gtggagggtgaggtgtactcggcgggatactgcgcggccaagcacggtctggtcgggctg
acccgcgccctggcgatcgagttcaccaaggagaagatccgggtgaacgcgatctgtccg
ggcggcatgccaaccccgcaggccaccgagttcaccgcgcccgcgaacgccgactgggac
ctgatcctgcggatcgcgtcgccgcgtggattcatggatcccgtcgacgtcgccaaatcc
gttgcgttccttgccagtgacgacgccgcggctatccacggcgccgtctatcgggtggac
aacggaaagggcgccggctag

DBGET integrated database retrieval system