KEGG   Mycobacterium rhodesiae: MycrhN_5330Help
Entry
MycrhN_5330       CDS       T01685                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mrh  Mycobacterium rhodesiae
Pathway
mrh00620  Pyruvate metabolism
mrh00680  Methane metabolism
mrh01100  Metabolic pathways
mrh01120  Microbial metabolism in diverse environments
mrh01200  Carbon metabolism
Module
mrh_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mrh00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MycrhN_5330
  Energy metabolism
   00680 Methane metabolism
    MycrhN_5330
Enzymes [BR:mrh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     MycrhN_5330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AEV75805
UniProt: G8RHD5
LinkDB All DBs
Position
complement(5419045..5421834)
Genome map
AA seq 929 aa AA seqDB search
MAEVGGLEPIGAVQRTKVGREATEPMREDIRLLGTILGETVREQNGEAVFELVERARVES
FRVRRSEIDRAELASMFDGIDIHQAIPVIRAFTHFALLANVAEDIHRERRRVIHVAAGEP
PQDSSLAATYAKLDTARLDAATVSDALAGALVSPVITAHPTETRRRTVFDTQHRITELMR
LRMKGHEHTDDGRGIERELRRNILTLWQTALIRLSRLKIQDEIETGLRYYAAAFFEVVPR
VNAEVRNALRYRWPDTDLLAEPILRPGSWIGGDRDGNPNVTAEVVRLATGSAAYTALEHY
FTEITALEEELSMSARLVKISDALTALADQCREPARADEPYRRALRAIHARLTTTAYDIL
DRQPEHELDLGLDRYDTPAELLADLDVVDESLRTNGSAVLADDRLARLREAVHVFGFHLS
GLDMRQNSEVHEEVIAELLAWAGVHPDYASLSEPDRVELLAAEVATRRPLTSDGAELSEL
ARKELDIVAAAARAVRVLGPAAVPNYVISMCQSVSDMLEVAVLLKEVGLLDVSGSQAYAP
VRIVPLFETIDDLQRGSSILEQALDLPVYRALVSARGDSQEVMLGYSDSNKDGGYLAANW
ALYRAELDLVESARKTGIRLRLFHGRGGTVGRGGGPSYDAIRAQPPGAVRGSLRITEQGE
VIAAKYAEPQIAHRNLETLLAATLEASLLDIEGLGDAAGPAYDVLDDIAARAQRSYAELV
HETPGFVEYFKASTPVSEIGALNIGSRPTSRKPTTSISDLRAIPWVLAWSQSRVMLPGWY
GTGTAFEDWINQGDGRLEVLRDLYQRWPFFRTVLSNMAQVLAKSDMGLAAHYSELVDDTE
LRRRVFDKIVAEHTRTIRMHKLITGQDDLLADNPALARSVFNRFPYLEPLNHLQVELLRR
YRSGDDDELVQRGILLTMSGLATALRNSG
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggttggcggactggaacccatcggtgcggtccagcgcacaaaggtaggccgc
gaagccaccgagccgatgcgtgaagacatccgattgttgggcaccatcctcggcgagacc
gtccgcgagcagaacggcgaggcggtattcgagctcgtcgaacgtgcccgtgtggaatcg
ttccgcgtgcggcgctccgagatcgaccgtgccgagcttgcctcgatgttcgacgggatc
gacatccaccaggccatccccgtcatccgcgccttcacccacttcgcgttgctggccaac
gtcgccgaggacatccatcgggaacgtcgccgcgtgatccacgtcgccgcgggggagccg
ccacaggacagcagcttggccgcgacgtacgccaaactcgacacggccagactcgatgcg
gcgacagtgtccgacgctctggccggggcgctggtgtcgccggtgatcacggcgcatccg
accgagacccggcggcgcaccgtcttcgacacccagcaccgcatcaccgaactgatgcga
ctgcgcatgaagggccatgagcacaccgacgacggccgcgggatcgaacgtgagctgcgc
cgcaacatcctgacgctgtggcagacggcactgatccgcttgtcgcggttgaagatccag
gacgagatcgaaaccgggctccgctattacgcggcagccttcttcgaggtcgtgccgcgg
gtcaacgccgaggtgcgcaacgcgctgcgataccgatggcccgataccgacctgctcgcc
gaaccgatcctgcggccgggctcgtggatcggtggggaccgtgacggcaatcccaacgtc
accgccgaggtcgtgcgattggcgaccggaagtgccgcatacacggcgctggagcactac
ttcaccgagatcaccgcgctcgaagaggaactgtcgatgtcggcgcggctggtgaagatc
agcgacgcgctgactgcccttgccgaccagtgtcgcgagcctgcccgcgccgacgagccg
taccgccgcgcgctgcgggccatccatgcgcgcctgacgacgacggcttacgacatcctt
gaccgccagcccgaacacgaactcgacctcggactcgaccgctacgacactccggccgaa
ctgctggccgacctcgacgtcgtcgacgagtcgctgcgtaccaacggcagcgcggtgctg
gccgacgatcggctcgctcggctgcgagaagccgtgcatgtcttcgggtttcacctctcc
ggactggacatgcggcagaactccgaggtgcacgaggaggtcattgccgagttgctggcg
tgggccggcgtgcatcccgactacgcttcgctgtccgaaccggaccgcgtcgagttgctc
gccgccgaagtggcgacgcgccgaccgctgacgtccgacggcgctgagctctcggagttg
gcgcgcaaggaactcgacatcgtcgcggcggccgcccgcgccgtcagggtgttgggacct
gcggctgtgccgaactacgtcatctcgatgtgtcagtcggtgtccgacatgctcgaggtt
gcggttctgctcaaagaagtgggcctgctggatgtttccggctcgcaggcctacgcgccc
gtgcggatcgtcccgctgttcgagaccatcgacgacctccagcgcggctcgtcgatcctc
gagcaggcgctcgaccttcccgtgtaccgagcgctcgtgtctgcccgtggggacagccag
gaagtgatgctcggctattccgactcgaacaaggacggcggatacctcgcggcaaactgg
gcgttgtaccgggccgagctcgacctggtcgagtctgcgcgtaagacgggaatccggttg
cgcctcttccacggtcgcggtgggaccgtcggacgcggtggcggaccgagctacgacgcc
atccgggcgcagccgccaggcgcggtgcgcggttcacttcggatcaccgagcagggtgag
gtgatcgcggccaagtatgccgagccgcagattgcgcaccgcaacctcgaaaccctgttg
gccgcgaccctggaagcctcgctgctggacatcgaggggctgggcgacgccgcggggccg
gcctacgacgtgctcgacgacatcgccgcccgcgcgcagcggtcctacgccgagttggtg
catgagacaccgggtttcgttgaatacttcaaggcgtcgacgccggtgagcgaaatcggt
gcactcaacatcggcagcaggccgacctcacgcaaacccacgacgtcgatctccgacctg
cgagcgatcccgtgggttctggcctggagccaatcacgggtcatgctgcccggctggtac
gggacggggacggcgttcgaggattggatcaaccagggcgacgggcgcctcgaggtgctg
cgcgacctgtaccagcgctggccgttcttccgcacggtgctgtcgaacatggcccaggtc
ctcgccaagtccgacatgggacttgcggcgcactattcggagctggtcgatgacaccgaa
ctgcgtcggcgcgtgttcgacaagatcgtcgccgagcacacccgcacgatccggatgcac
aagctcatcaccggtcaggatgacctgctcgccgacaacccggcgttggcgcgatcggtg
ttcaaccggttcccgtacctcgagccgctgaaccatctacaggtggaactgttgcggcgt
taccgatccggcgacgacgacgagctagtccagcgcggcatcctcctcacgatgagtggg
ctcgcgaccgcgctgcgcaacagcggctag

DBGET integrated database retrieval system