KEGG   Mycolicibacterium rhodesiae: MycrhN_5888Help
Entry
MycrhN_5888       CDS       T01685                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mrh  Mycolicibacterium rhodesiae
Pathway
mrh00473  D-Alanine metabolism
mrh00550  Peptidoglycan biosynthesis
mrh01100  Metabolic pathways
mrh01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mrh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MycrhN_5888
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MycrhN_5888
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MycrhN_5888
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mrh01011]
    MycrhN_5888
Enzymes [BR:mrh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MycrhN_5888
Peptidoglycan biosynthesis and degradation proteins [BR:mrh01011]
 Precursor biosynthesis
  Amino acid ligase
   MycrhN_5888
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp RimK ATP-grasp_3 CPSase_L_D2 ATP-grasp_4 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AEV76353
UniProt: G8RPC4
LinkDB All DBs
Position
complement(5965423..5966580)
Genome map
AA seq 385 aa AA seqDB search
MNAHDEPDAALPAASDVGASGRIRVAVVYGGRSSEHAISCVSAGSIMRNLDPQRFDVVAV
GITPGGTWMLTDAEPDTLAIADRQLPQVTSASGRELALAVDPGRGGELVSLSAGAGEVLG
AVDVVFPVLHGPYGEDGTIQGLLELAGVPYVGAGVLASASGMDKEFTKKLLAAEGLPIGD
QVVLRPRQQTVSLEDRERLGLPVFVKPSRGGSSIGVSRVTASDQLPAAIELARRNDPKVI
VEAAIVGRELECGVLEFPDGRVEASTVGEIRVAGVRGREDSFYDFATKYLDDAAELDVPA
KIDDTIADEVRQLAIRAFQAIDCQGLARVDFFLTENGPIINEINTMPGFTTISMYPRMWA
ASGVDYPTLLATMVETALKRGTGLR
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgcccacgatgagcccgacgccgccctgccggcggcatcagatgtgggcgcgtcc
ggacgcattcgcgtcgccgttgtctacggcggacgcagctctgagcacgcaatttcctgc
gtctccgcaggcagcatcatgcgcaacctcgatccgcagcgtttcgacgtggtcgccgtc
ggcatcaccccaggcggcacgtggatgctcacggacgcggagcccgacaccctggcgatc
gccgacaggcagttaccgcaggtcaccagcgcatccggcagggagctcgcccttgccgtc
gacccggggcgaggtggcgagctggtgtcactcagcgctggcgccggtgaggtgctcggt
gcggtggacgtggtcttcccggtgctgcacggtccttatggcgaggacggcaccatccag
gggcttctcgaattggcaggcgtgccgtacgtcggcgccggcgtactggccagcgcgtcg
ggcatggacaaggagttcaccaagaagctgttggccgcggagggtctgccgatcggcgac
caggtcgtgctgcgcccgcgacagcagaccgtgagcctcgaagaccgcgaacggctgggg
ctgccggtgttcgtcaagccttcgcgcggtgggtcgtcgatcggggtgagccgggtgacg
gcgtcggatcagctacccgcggcgatcgagctggcaagacgtaacgatcccaaggtgatc
gtcgaggccgcgatcgtcggacgtgaattggagtgcggggtactggaattccccgacggc
agagtcgaagcgagcaccgtcggcgagatccgggtggcgggtgtgcgcggtcgtgaggac
tctttctacgacttcgcgacgaaatatctcgacgacgccgccgagctcgacgtgcccgcc
aagatcgatgacaccatcgcagatgaagtgcgccaattggcgattcgggcattccaggcc
atcgactgtcagggtctggctcgtgtcgacttcttcctcaccgagaacggcccgatcatc
aacgagatcaacaccatgccgggattcaccaccatctcgatgtatccgaggatgtgggca
gccagcggggtcgactatccgacgctgttggcgactatggtcgaaacggccctgaagcgc
ggcacgggtctgcgttaa

DBGET integrated database retrieval system