KEGG   Minicystis rosea: A7982_00247Help
Entry
A7982_00247       CDS       T04613                                 

Definition
(GenBank) Dihydrolipoamide acyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
mrm  Minicystis rosea
Pathway
mrm00010  Glycolysis / Gluconeogenesis
mrm00020  Citrate cycle (TCA cycle)
mrm00620  Pyruvate metabolism
mrm01100  Metabolic pathways
mrm01110  Biosynthesis of secondary metabolites
mrm01120  Microbial metabolism in diverse environments
mrm01130  Biosynthesis of antibiotics
mrm01200  Carbon metabolism
Module
mrm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7982_00247
   00020 Citrate cycle (TCA cycle)
    A7982_00247
   00620 Pyruvate metabolism
    A7982_00247
Enzymes [BR:mrm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A7982_00247
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding
Motif
Other DBs
NCBI-ProteinID: APR74901
UniProt: A0A1L6KZH7
LinkDB All DBs
Position
261751..263166
Genome map
AA seq 471 aa AA seqDB search
MKTYEFKLPDIGEGVTEGEIVKWLISPGDAVAEDQPIVEVMTDKATVTITAPKAGKVLET
RGSVGGIVPVHSVLVVFDLGGDAPATATQAEPEKKGEPAATAVGDIKESLPGMNLMSAAP
APVHVNGHAKTASYFNDKPLATPATRALARELGIDLRTVPPTGPYGRVTKDDLRAHGQGS
SPATTVAPMAQRVPDLRPVADSTPRPEPTAPQARTVVEPAAPSPVTTRAPMKIAPSAELE
ERTPLRGVRKRIFEGMTRSKHTAAHFTFVEECDVTALKDLRARLRPAAEKAGVKLTFLPF
IVKATVAALKKHPSLNSAFDESTQEIVTRRYYDIGIASATEAGLIVPVVRDADRKSILDV
ARDIQRLGEDTKAGKVSPADLGGSTFTITSLGAQGGLFATPILNFPEVGILGVHQMKQKP
VVRDGQIVIGDVMLLSLSFDHRIIDGHVGAAFAYEIIGYLQDPDRLFLEMA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaagacctacgagttcaagctgcccgacatcggcgagggcgtgaccgagggcgagatc
gtcaaatggctgatctcgccgggcgatgcggtggccgaagatcagccgatcgtcgaagtg
atgaccgacaaggcgaccgtcaccatcaccgcgccgaaggccggcaaggtgctggagacg
cgcggctccgtgggcgggatcgtgcccgtgcactcggtgctggtggtgttcgatctcggc
ggcgacgcgccggccacggcgacgcaggccgagcccgagaagaagggcgagccggcggcg
acggcggtgggcgacatcaaggagagcctgccggggatgaacctgatgagcgcggccccg
gcgccggtgcacgtcaacggccacgccaagacggcgagctacttcaacgacaagccgctg
gccacgccggcgacgcgcgccctcgcgcgcgagctcgggatcgatctgcgcaccgtcccg
cccaccggcccctacggccgcgtgaccaaggacgatctgcgcgcgcacgggcagggctcg
tcgcccgcgacgacggtcgcgccgatggcgcagcgcgtgccggatctgcggcccgtcgcg
gactccacgccgcgccccgagccgaccgcgccgcaggcgcgcaccgtggtggagcccgcg
gctccctcgccggtgacgacgcgcgcgccgatgaagatcgccccctccgccgagctcgag
gagcggaccccgctccgcggcgtgcgcaagcggatcttcgagggcatgacgcgctcgaag
cacacggcggcgcacttcaccttcgtcgaggagtgcgacgtcacggcgctcaaggatctc
cgcgcgcgcctgcgccccgcggccgagaaggcgggcgtgaagctcacgttcctgcccttc
atcgtgaaggccacggtcgccgcgctgaagaagcacccctcgctcaacagcgccttcgac
gagtccacgcaggagatcgtgacccgtcggtactacgacatcggcatcgcctccgcgacc
gaggccggcctgatcgtgccggtcgtgcgcgacgccgatcggaagagcatcctcgacgtg
gcgcgcgacatccagcggctcggcgaggacaccaaggcgggcaaggtcagcccggcggat
ctcggtggatcgaccttcaccatcacctcgctgggcgcgcagggcggcctcttcgccacg
ccgatcctgaacttccccgaggtggggatcctcggcgtgcaccagatgaagcagaagccg
gtcgtgcgcgatgggcagatcgtcatcggtgacgtgatgctgctctcgctctcgttcgat
caccgcatcatcgacgggcacgtgggcgcggcgttcgcatacgagatcatcggctatctc
caagacccggatcggctgttcctcgaaatggcctga

DBGET integrated database retrieval system