KEGG   Minicystis rosea: A7982_02623Help
Entry
A7982_02623       CDS       T04613                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mrm  Minicystis rosea
Brite
Enzymes [BR:mrm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A7982_02623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: APR77276
UniProt: A0A1L6L6D7
LinkDB All DBs
Position
3000925..3001476
Genome map
AA seq 183 aa AA seqDB search
MSMSSTSIVLGMIALSFVASCAHGETCAGVACGQAPSAPRATGTFQAKEGTTVSGTVEAI
EEGNVVRLRVNLKGAPPGIHGIHIHEKGDCSAPDFTSAGGHFNPTNASHACPPTEPRHAG
DFGNIEIAADGTGRLDMTSDHITVSPGATSVVGRSVVLHHGKDDCASQPAGDSGMRIGCA
VLK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
ttgagcatgtcgtcgacatccatcgtgctgggcatgatcgctctatcgttcgtcgcctcg
tgcgcgcacggcgagacctgcgccggtgtggcgtgtggccaagccccgagcgcgccgcgc
gcgacaggcacgttccaagcgaaggagggaacgaccgtctcgggcacggtcgaagcgatc
gaggaaggaaacgtcgtccggctacgcgtcaacctgaagggcgccccgccgggcatccat
ggcattcacatccacgagaagggcgattgcagcgcccccgatttcacgtctgccggcggc
cacttcaatccgaccaacgcatcgcacgcctgcccgcccacggagccgcgccacgcgggt
gatttcggcaacatcgagatcgccgcggacggcactggtcggctcgacatgacgtcggat
cacatcaccgtctcaccgggcgcgacctcggtggtcggccgctccgtggtgcttcatcac
ggcaaggacgattgcgcctcgcagcccgcgggcgactcggggatgcgcatcgggtgcgcg
gtgttgaagtag

DBGET integrated database retrieval system