KEGG   Minicystis rosea: A7982_03788Help
Entry
A7982_03788       CDS       T04613                                 

Definition
(GenBank) Peptidyl-dipeptidase A precursor
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
mrm  Minicystis rosea
Brite
Enzymes [BR:mrm01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     A7982_03788
Peptidases [BR:mrm01002]
 Metallo Peptidases
  Family M2
   A7982_03788
Exosome [BR:mrm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A7982_03788
CD molecules [BR:mrm04090]
 Proteins
  A7982_03788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M2
Motif
Other DBs
NCBI-ProteinID: APR78441
UniProt: A0A1L6L9H9
LinkDB All DBs
Position
4438343..4440241
Genome map
AA seq 632 aa AA seqDB search
MIRRSSIHAIPFAIASLAVVACESLPPPPPPQVASTPAPEQSAAPAAAPPTEEEARAFLA
AVDGDLRKLWTASSRAAWVAQNFITDDSEALSASAEEASMEFMSRTIKSATRFDGVKLPS
DLTRQLWLLKIGSQLPAPSDPKERAELAETSVAMTGEYGKGKYCPERLKNDPKAKKKCLS
LGDLTNIMEKSRKYDELLDAWRGWHSIAPPIKPKFVRYVELGNKGAREIGFKDLGELWRS
GYDMPAADFEADTDRLWSQVKPLYDDLHCYVRSRLQKAYGKDKIPDKAPIPAHLLGNMWA
QEWQNIYELVEPYKGEAPLDVTKKIKQKKLDEKAMVRIGEGFFVSLGLDPLPKSFWERSL
FRKPADRDVVCHASAWDVGFNDDLRIKMCIEPKEDDLITIHHELGHDYYFHYYFKLPMLY
QQGANDGFHEGIGDTLALSVTPTYLKSIGLLDKVPDNEKGELNVLLKNALDKVAFLPFGK
IIDQWRWDVFSGKTPPAEYNKAWWELRRKYQGVAPPVARTEADFDPGAKYHVPGNTPYVR
YFLARIYQFQFHRALCKAAGYTGPLHKCSIHGSKAAGDKLRAMLAMGASKPWPEALAAIS
GEHEADASAMLAYFAPLSKWLKEQNKGETCGW
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
gtgatccgccgctcctcgatccacgccattcccttcgccatcgcctccctcgccgtcgtc
gcctgcgagagcttgccgccgcctccgccgccgcaggtggcgtcgacacccgcgcccgag
cagagcgccgcgccggccgccgcgccgccgaccgaagaagaggcgcgcgctttcctggcc
gcggtcgacggcgatctgcgcaagctgtggacggcgtcttcgcgcgccgcgtgggtcgcg
cagaacttcatcaccgacgacagcgaggcgctctccgcctccgccgaagaggcgagcatg
gagttcatgtcgcgcaccatcaagtccgcgacgcgcttcgacggggtcaagctcccgtcc
gatctcacccgccagctctggctcctcaagatcggcagtcagctccccgccccgagcgat
ccgaaggagcgcgccgagctcgccgagacgagcgtggccatgaccggcgagtacggcaaa
ggcaagtattgccccgagcgcctgaagaacgatcccaaggccaagaagaagtgtctctcg
ctcggcgatctcaccaacatcatggagaagagccgcaagtacgacgagctcctcgacgcc
tggcgcggctggcactccatcgctccgcccatcaagcccaagttcgtccgctacgtcgag
ctcggcaacaagggcgcgcgggagatcggcttcaaggatctcggcgagctctggcgctcc
ggctacgacatgccggccgccgatttcgaggccgacaccgaccgtctctggagccaggtc
aaaccgctctacgacgatctccactgctacgtccggagccgcctgcaaaaggcctacggc
aaggacaagatccccgacaaggcccccatccccgcgcacctcctcggcaacatgtgggcg
caggagtggcaaaacatctacgagctcgtggagccctacaagggtgaagccccgctcgac
gtcaccaagaagatcaagcagaagaagctcgacgagaaggccatggtgcgcatcggcgaa
ggcttcttcgtctcgctcggcctcgatccgctgccgaaatcgttctgggagcgctcgctc
ttccggaagccggccgaccgcgacgtggtctgtcacgcgagcgcgtgggacgtcggcttc
aacgacgatctgcgcatcaagatgtgcatcgagccgaaggaggacgatctcatcaccatc
caccacgagctcgggcacgattactacttccactattatttcaagctgcccatgctctat
cagcagggcgccaacgacggcttccacgagggcatcggcgacacgctggccctcagcgtg
acgcccacctacctgaagagcatcggtctcctcgacaaggtgcccgacaacgagaagggc
gagctcaacgtcctgctcaagaacgcgctcgacaaggtggcgttcctcccgttcggcaag
atcatcgatcaatggcggtgggacgtgttctccggcaagaccccgcccgccgagtacaac
aaggcttggtgggagctgcgccgcaaataccaaggtgtggcgccgcccgtcgcgcgcacc
gaggccgacttcgatcccggcgcgaagtaccacgttcccggcaacacgccgtacgtgcgc
tacttcctggcgcgcatctaccagttccaattccaccgcgcgctctgcaaggccgccggc
tacacgggcccgctccacaagtgctcgatccacgggagcaaggccgccggcgacaagctc
cgcgccatgctggccatgggcgcgagcaagccttggcccgaagccctcgcggccatcagc
ggcgagcacgaggccgacgccagcgccatgctcgcgtacttcgctccgctctcgaaatgg
ctgaaggagcagaacaagggcgagacctgcggctggtga

DBGET integrated database retrieval system