KEGG   Minicystis rosea: A7982_04128Help
Entry
A7982_04128       CDS       T04613                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mrm  Minicystis rosea
Pathway
mrm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A7982_04128
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mrm02000]
    A7982_04128
Enzymes [BR:mrm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A7982_04128
Transporters [BR:mrm02000]
 Other Transporters
  Pores ion channels [TC:1]
   A7982_04128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N_2 GST_N GST_N_3 GST_C_6 Tom37
Motif
Other DBs
NCBI-ProteinID: APR78781
UniProt: A0A1L6LAH4
LinkDB All DBs
Position
4829342..4829956
Genome map
AA seq 204 aa AA seqDB search
MKLYYSPGACSLSPHIVLREAGLPFELQRVDTRSKQLKGGGDFTEINDKGMVPALQLDDG
SVLTEGPAIVQFLADQKPETGLVPKAGTMERYRLAEWLNFISTELHKGFTPLFNPATPEE
YKLMVREALAKRFGLVQKRLEGKTWAMGDQFTVADAYLFTVLSWTKFVGVDLSPWPVLVA
YLERVAARPTVTEALVAEGLVKKS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaagctctactacagcccgggcgcctgttctctctccccccacatcgtgctgcgcgag
gcgggtctcccgttcgagctgcagcgtgtcgacacgcgctcgaagcagctcaagggcggc
ggcgacttcaccgagatcaacgacaagggcatggtccccgcgctccagctcgacgacggc
tcggtgctcaccgagggccccgccatcgtgcagttcctcgccgatcagaagcccgagacg
ggcctcgtgcccaaggccggcacgatggagcgctaccgtctcgcggagtggctcaacttc
atcagcacggagctccacaagggcttcacgccgctcttcaaccccgccacgccggaagaa
tacaagctcatggtgagggaggcgctcgccaaacgcttcggcctcgtgcagaagcggctc
gaagggaagacgtgggccatgggcgatcagttcacggtcgccgacgcctacctcttcacc
gtcctcagctggacgaagttcgtcggcgtcgatctcagcccgtggcccgtgctcgtcgcg
tacctcgagcgcgtcgcggcgcgcccgacggtcaccgaggcgctcgtggccgagggcctc
gtcaagaagtcctga

DBGET integrated database retrieval system