KEGG   Minicystis rosea: A7982_07446Help
Entry
A7982_07446       CDS       T04613                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
mrm  Minicystis rosea
Brite
Enzymes [BR:mrm01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A7982_07446
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: APR82097
UniProt: A0A1L6LK10
LinkDB All DBs
Position
8597054..8597665
Genome map
AA seq 203 aa AA seqDB search
MARDAKNFDHLLGGNAKGLSDQQLKAHFTLYQGYVKKLNEIREKLGTADRSAPNYSFNEY
SELKRREPVAYNGTVLHEMYFENLGNGSTQPNEVTKRLITDSFGSFDNWVTDAKACLLSA
HGWLLTIFDYADGKLHNNLIRSEHDVGLFANVHAMIAVDAWEHAYFFDYQTAKAKYVDNA
LSGLNWDVLNKRIGMVSGYGQKK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggctcgcgacgcgaagaacttcgatcatctcctcggcggcaacgccaagggactcagc
gaccagcagctcaaggcgcacttcacgctgtaccaaggctacgtcaagaagctcaacgag
atccgcgagaagctcggcaccgccgaccgcagcgcgcccaactactcgttcaacgagtac
agcgagctgaagcgccgtgagcccgtcgcctacaacggcacggtgctccacgagatgtat
ttcgagaacctcggcaacggctcgacacagcccaacgaggtgacgaagcgtctcatcacc
gacagcttcggcagcttcgacaactgggtcaccgacgccaaggcgtgcctcctcagcgcc
catggctggctcctcaccatcttcgattacgcggacggcaagctccacaacaacctgatc
cgcagcgagcacgacgtgggcctcttcgccaacgtccacgcgatgatcgcggtcgacgcc
tgggagcacgcttatttcttcgactaccaaacggcaaaggccaagtacgtggacaacgcg
ctctccggcctgaactgggacgtgctcaacaagcgcatcggcatggtgtccggctacggc
cagaagaagtga

DBGET integrated database retrieval system