KEGG   Minicystis rosea: A7982_07793Help
Entry
A7982_07793       CDS       T04613                                 

Definition
(GenBank) Glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
mrm  Minicystis rosea
Pathway
mrm00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:mrm00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    A7982_07793
Enzymes [BR:mrm01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     A7982_07793
Transporters [BR:mrm02000]
 Other Transporters
  Pores ion channels [TC:1]
   A7982_07793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: APR82444
UniProt: A0A1L6LKW6
LinkDB All DBs
Position
8994668..8995333
Genome map
AA seq 221 aa AA seqDB search
MSDSHKIKRGDLVFYHSPNSRAAGVRFLLEELGADYRLEVLNMKAGEQRKAPFLAVNPLG
KVPAIVHDGALVTEQGAIYLYLADLFPEAGLAPAIGDKDRGPYLRWLFLYGSCFEPALVD
RSMKRDPAPQGTSPYGDWDTLFDTVLAAIRKGPYLLGDRLTAADLLWGMALRWMTMFKLV
PASPEVTGYSERICSRPAFARVSAADAELAAAHDAAAAQKG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgagcgattcgcacaagatcaagagaggggacctcgtcttttaccactcgcccaattcg
cgcgcggccggcgtgcgcttcctgctcgaggagctcggcgccgactatcggctcgaggtc
ctcaacatgaaggccggcgagcagcggaaggcgccgtttctcgcggtgaacccgctcggg
aaagtgccggccatcgtgcacgacggcgcgctcgtgaccgagcagggcgccatttatctt
tacctcgccgatctgtttccggaggcgggcctcgcgccggccatcggtgacaaagatcgc
gggccttacctgcgctggctcttcctttatggatcctgcttcgagccggccctcgtcgat
cgctcgatgaagcgtgatccggccccgcaggggacgagcccgtacggcgactgggacacg
ctgttcgacaccgtcctcgcggcgatccggaaggggccttatctgctcggtgatcgcttg
acggccgccgacctgctctggggcatggcgctgcggtggatgacgatgttcaagctcgtg
cccgcgtcgccggaggtcacgggttacagcgagcgcatctgtagccggcccgcgttcgcg
cgggtgtccgccgccgacgccgagctcgcggccgcacacgacgccgccgcagcccagaag
ggttga

DBGET integrated database retrieval system