KEGG   Minicystis rosea: A7982_09262Help
Entry
A7982_09262       CDS       T04613                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
mrm  Minicystis rosea
Pathway
mrm00020  Citrate cycle (TCA cycle)
mrm00190  Oxidative phosphorylation
mrm00650  Butanoate metabolism
mrm01100  Metabolic pathways
mrm01110  Biosynthesis of secondary metabolites
mrm01120  Microbial metabolism in diverse environments
mrm01130  Biosynthesis of antibiotics
mrm01200  Carbon metabolism
Module
mrm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mrm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A7982_09262
   00650 Butanoate metabolism
    A7982_09262
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A7982_09262
Enzymes [BR:mrm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A7982_09262
    1.3.5.4  fumarate reductase (quinol)
     A7982_09262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_17 Fer4_9 Fer4_18 Fer4_16 Fer4_2 Fer4_7 Fer4_13 Fer4 Fer4_4
Motif
Other DBs
NCBI-ProteinID: APR83913
UniProt: A0A1L6LQE0
LinkDB All DBs
Position
complement(10594622..10595410)
Genome map
AA seq 262 aa AA seqDB search
MAETNESKGSGRLVHLKVRRQDGRDMPETRRWEEFKVPYLPQMNVNSALEQIRKNPVTLD
GKEVAPPVWEAACLEEVCGSCTMIINGRVRQACSALVEQIAPNGEVITIEPMSKFPCERD
LVVDRSRMFDNLKRVKAWIDLDGTHELGPGPRESQEQQQERYPLSRCMTCGCCVEACPQF
NESSPFIGPAAINQVRLFNMHPSGAMHRTARLESLMTEGGIADCGKAQNCVEVCPKEIPL
VDSISSVARDTTKHMLFGWLLK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atggccgagacgaacgaaagcaagggaagcggaaggctcgttcacctcaaggtgcgccgg
caggacgggcgcgacatgcccgagacgcgccggtgggaggagttcaaggtcccctacctg
ccgcagatgaacgtcaacagcgcgctggagcagatccggaagaacccggtcaccctcgac
ggcaaggaggtcgctccgcccgtctgggaggccgcctgtctcgaggaggtctgcggctcc
tgcacgatgatcatcaacggccgcgtgcggcaggcctgctccgcgctggtggagcagatc
gcgcccaacggcgaggtgatcaccatcgagccgatgagcaagttcccctgcgagcgcgac
ctcgtcgtcgatcgcagccgcatgttcgacaacctgaagcgcgtgaaggcctggatcgat
ctcgacggcacccacgagctcggccccggcccgcgcgagtcgcaggagcagcagcaggag
cgctacccgctctcgcgctgcatgacctgcggctgctgcgtggaggcgtgcccgcagttc
aacgagtcgtcgccgttcatcgggccggccgcgatcaaccaggtgcgcctcttcaacatg
cacccctcgggcgcgatgcaccgcacggcgcgcctcgagtcgctcatgaccgagggcggc
atcgccgactgcggcaaggcgcagaactgcgtcgaggtctgccccaaggagatcccgctc
gtcgactcgatctccagcgtcgcccgcgacaccacgaagcacatgctcttcggctggctg
ctgaagtag

DBGET integrated database retrieval system