KEGG   Minicystis rosea: A7982_09263Help
Entry
A7982_09263       CDS       T04613                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit protein
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
mrm  Minicystis rosea
Pathway
mrm00020  Citrate cycle (TCA cycle)
mrm00190  Oxidative phosphorylation
mrm00650  Butanoate metabolism
mrm01100  Metabolic pathways
mrm01110  Biosynthesis of secondary metabolites
mrm01120  Microbial metabolism in diverse environments
mrm01130  Biosynthesis of antibiotics
mrm01200  Carbon metabolism
Module
mrm_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mrm_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    A7982_09263
   00650 Butanoate metabolism
    A7982_09263
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A7982_09263
Enzymes [BR:mrm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     A7982_09263
    1.3.5.4  fumarate reductase (quinol)
     A7982_09263
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA DAO DCX HI0933_like
Motif
Other DBs
NCBI-ProteinID: APR83914
UniProt: A0A1L6LQ47
LinkDB All DBs
Position
complement(10595491..10597518)
Genome map
AA seq 675 aa AA seqDB search
MAAKSTIRSEGGKVRRVIVVGGGLAGLMTVIKLCEAKVPVDLISLVPVKRSHSVCAQGGI
NASVNTKGEGDSPQVHLEETAYGGDFLANQPPVKGMADAAPGIVYMLDRMGVPFNRTPEG
LLDFRRFGGTLFHRTAFAGATTGQQLLYALDEQVRRWETQDVVDEHGVSIPGEKMVRKFE
FWDFLQAVIDDNGVCVGAIAQDLKTMAIRHFRGDAVVLATGGCGIIFGRSTLSVICTGTA
ASAVYQQGAVYANGEFIQVHPTAIPGADKLRLISESARGEGGRVWVPKDGKDKRNPKDIP
EKERDYFLERMYPGYGNLVPRDIASRALFKTCFHEGRGIFNEKTGKNENEVYLDLTHKDE
KFLRSKLAGILEIYEKFVGVDPYHNPMKVFPAVHYSMGGLWVDYEKDARGSLKTGSPRNH
STNIPGLYAVGEVDYQYHGANRLGANSLLSCIWGGMACGPAVATYQKNLPQSSFDLPQSI
FDKSEKRAQGEYERVLTQNQDRKDAENPYVLHAELGETMLRDCTIERHNKTLEKVLEKIS
ELDERVKKVKTPDTSARVNQGAQFVRHLENMLVLARVIATGAKNRDESRGAHYKPAFPTR
NDADWLRTTMAVHEQKGAVKYVRELDYSVGGKSIHVTDAVDTSLVTPRERKYEQAGAASA
AATGKLPEGQQKKIA
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atggcagcaaagagcacgatccggagcgaaggcggtaaggtgaggcgcgtgatcgtcgtc
ggcggcgggctcgccggcttgatgacggtcatcaagctctgcgaggccaaggtcccggtg
gatctgatctcgctcgtgccggtgaagcggtcccactcggtgtgcgcgcagggcggcatc
aacgcctccgtgaacaccaagggcgagggcgacagcccgcaggtgcacctcgaggagacc
gcgtacggcggcgacttcctcgccaaccagccgcccgtgaagggcatggccgacgcggcc
cccggcatcgtctacatgctcgaccgcatgggcgtgcccttcaaccgcacgcccgaaggt
ctgctcgacttccgccgcttcggcggcacgctcttccaccgcaccgcgttcgcgggcgcg
accacggggcagcagctcctctacgccctcgacgagcaggtgcgccgctgggagacgcag
gacgtcgtcgacgagcacggcgtctccatccccggcgagaagatggtgcggaagttcgag
ttctgggacttcctccaggccgtcatcgacgacaacggcgtgtgcgtcggcgccatcgcg
caggacctgaagacgatggccatccgccacttccgcggcgacgcggtcgtcctcgcgacg
ggcggctgcggcatcatcttcggccgctcgacgctgagcgtgatctgcaccggcaccgcg
gcctcggccgtgtaccagcagggcgcggtctacgcgaacggcgagttcatccaggtgcac
ccgaccgcgatcccgggcgccgacaagctccgcctcatcagcgagagcgcccgcggcgaa
ggcggccgcgtgtgggtgccgaaggacggcaaggacaagcgcaaccccaaggacatcccc
gagaaggagcgcgactacttcctcgagcggatgtacccgggctacggcaacctcgtgccc
cgcgacatcgcctcgcgcgcgctcttcaagacgtgcttccacgagggccgcggcatcttc
aacgagaagaccggcaagaacgagaacgaggtctacctcgacctcacgcacaaggacgag
aagttcctccgctcgaagctcgcgggcatcctcgagatctacgagaagttcgtgggcgtc
gacccgtaccacaacccgatgaaggtcttcccggccgtgcactactcgatgggcggcctc
tgggtcgactacgagaaggacgcgcgcggctcgctgaagacgggctcgccgcgcaaccac
tcgaccaacatccccgggctctacgcggtgggcgaggtcgactaccagtaccacggcgcg
aaccgcctcggcgccaactcgctgctctcctgcatctggggtggcatggcctgcgggccc
gcggtggcgacgtaccaaaagaacctgccgcagagctcgttcgacctgccgcagtcgatc
ttcgacaagtccgagaagcgggcgcagggcgagtacgagcgcgtgctcacgcagaaccag
gatcgcaaggacgcggagaacccctacgtgcttcacgcggagctcggcgagacgatgctc
cgcgactgcaccatcgagcgccacaacaagacgctggagaaggtgctcgagaagatcagc
gagctcgacgagcgcgtgaagaaggtgaagacgcccgacacctcggcgcgcgtgaaccag
ggcgcccagttcgtgcggcacctggagaacatgctggtgctcgcccgcgtcatcgccacc
ggcgcgaagaaccgcgacgagtcgcgcggcgcccactacaagccggcgttcccgacgcgc
aacgacgccgactggctgcgcacgacgatggcggtccacgagcagaagggcgcggtgaag
tacgtccgcgagctcgactactcggtgggcggcaagagcatccacgtcaccgacgcggtc
gacaccagcttggtgacgccgcgcgagcgcaagtacgagcaggccggcgccgccagcgcc
gccgcgacgggcaagctgcccgaggggcagcagaagaagatcgcgtga

DBGET integrated database retrieval system