KEGG   Minicystis rosea: A7982_10389Help
Entry
A7982_10389       CDS       T04613                                 

Definition
(GenBank) ATP phosphoribosyltransferase regulatory subunit protein
  KO
K02502  ATP phosphoribosyltransferase regulatory subunit
Organism
mrm  Minicystis rosea
Pathway
mrm00340  Histidine metabolism
mrm01100  Metabolic pathways
mrm01110  Biosynthesis of secondary metabolites
mrm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mrm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    A7982_10389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_His ETF AAA_lid_4
Motif
Other DBs
NCBI-ProteinID: APR85040
UniProt: A0A1L6LTA3
LinkDB All DBs
Position
complement(11838375..11839787)
Genome map
AA seq 470 aa AA seqDB search
MTKPADSQSAFPTLGPEAVHHASERAREAPSLTSASPIESAPRALSHPLPAGLRDLLPEE
TRRRRALGREVLDHFDLHGYRLVTPPAFELAEVLERGLGALDPSDVLRFIEPESGEVAAL
RPDMTPQIARMVATRLGREPQPIRLCYEGTIVRRRQGRARRHRQVPQAGVELYGTVPGAS
PSEPATLAGDLEILRLAASVADRLGLAEAAIDLGHASIARSLIESVPRSLAAEVGDALGQ
KDGARVERLLAGRPNASTLARLGDLHGGGPGEISAEALFAQAAPLLEGSESAAKALRELQ
ALWTAARDSLGTVLRLDLGEVRGFAYYTGMIFHLLAPGPGEPIGAGGRYDDLLARFDAPM
PAVGFALYLDAVAWARESAGSSEVMRRSAVVAVDDAAESAALLAALRSRGVPAVACPVDS
AFAYATAWRYTHVVTASGEPRHFRAQIVGPQTIEAADRTPDGLAAALAQR
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
gtgacgaaaccggccgactcgcagagtgccttccccacgctggggcccgaggccgttcat
catgcgagcgagcgcgcgagagaggctccctctctcacctcggcatctccgatcgagagc
gcgccccgcgccctctctcaccctttgcctgcaggcctgcgcgatctcctccccgaggag
acacgacgccgacgtgcgctcggtcgcgaggtgctcgatcacttcgacctgcacggctat
cgcctcgtcacgccgccggcgttcgagctcgccgaggtcctcgagcgcggcctgggcgct
ctcgatccgtcggatgtgctgcgcttcatcgagcccgaatcgggcgaggtagcagccctc
cgcccggacatgaccccgcagatcgcgcgcatggtggcgacgcgcctcgggcgggagccg
cagccgatccggctttgttacgaggggaccatcgtgcgccggcgtcagggccgagcccgg
aggcatcgtcaggtcccgcaggccggtgtcgagctgtatggcaccgtccccggcgcctct
ccgagcgagccggcgacgctcgcgggggatctggagatcttgaggctcgcggcctccgtc
gccgatcgcctcggcctcgcggaagcggccatcgatctcggtcacgcatcgatcgcacgc
tcgctcatcgagagtgtgccgcgctcgctcgccgccgaagtgggcgacgccctcgggcag
aaggacggcgcgcgcgtggagcgtttgctcgccggccggccgaacgcatccacgctcgcg
cgcctcggtgatctccacggcggcggccccggcgagatctccgccgaagccttgttcgcg
caggccgcgccgctcctcgaaggcagcgagtccgcggcgaaggcgctgcgtgagcttcaa
gctttgtggacggcggcgcgcgactcgttgggcacggtgttgcgattggatctcggagag
gtccgcggcttcgcctattacaccgggatgatcttccatctgctcgcgccggggccgggc
gagcccatcggtgcgggcggtcgttacgacgatctgctcgcccgcttcgatgcgcccatg
ccggccgtcggcttcgcgctctatctcgatgccgtcgcgtgggcgcgggagtccgcggga
tcgagcgaggtgatgcgccggagcgcggtggtcgccgtcgacgacgcggccgagtccgct
gccctgctcgcggcgttgcgatcgcgtggggtcccggccgtcgcttgcccggtcgactct
gcgttcgcgtatgcgaccgcctggcgctacacccacgtcgtcacggcgagcggcgagccc
cggcacttccgggcgcagatcgttggacctcaaaccatcgaggccgcggaccgaacgccg
gatgggctggccgcggcgctcgcacagcgatga

DBGET integrated database retrieval system