KEGG   Melioribacter roseus: MROS_1053Help
Entry
MROS_1053         CDS       T02176                                 

Definition
(GenBank) FAD dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mro  Melioribacter roseus
Pathway
mro00564  Glycerophospholipid metabolism
mro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    MROS_1053
Enzymes [BR:mro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     MROS_1053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 HI0933_like GIDA Pyr_redox_2 Thi4 Pyr_redox_3 NAD_binding_8 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFN74293
UniProt: I6ZZ55
LinkDB All DBs
Position
1226824..1228404
Genome map
AA seq 526 aa AA seqDB search
MNRDIQLKRLLSDKDEVWDIIIIGGGATGLGAAVDAASRGFKTLLVEQYDFSKGTSSRST
KLVHGGVRYLAQGDLSLVFEALHERGLLMQNAPHLVKNQQFIIPNYEWWEGPFYNIGMKV
YDLMAGKLGLGPSEKISKEETLNAIPNLDPEGLLGGVIYYDGQFDDSRLAINLAQTAYEN
GAVLLNYVKAVGFTKDKEGILNGVNLLDVETGNAFHVKGKTFINAAGIFVGDIKNMDEGE
NSNSVALSRGIHIVLDKSFLQGNSAIMIPHTTDGRVLFAVPWHGKVILGTTDTEVDKPEI
EPRASEEEIDFLLSNSARYLSKDPQRSDILSVFAGLRPLAISEGKAIPTKDISRKHQISV
SPSGLITITGGKWTIYRKMGEDLIDHAILVGGLEERESVTKNLSIHGYLKNTNHNDPLYY
YGADKFQIEERILTKEKHLREPIHPHLPYIKAEIVWAVRNEMAITVEDFLARRIRALLLD
AKASIEMAPVAAEIMAKELKKDNAWAQNQINEYIKLARGYLSGYDE
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagacatacaacttaaacgacttttatccgataaagacgaagtttgggatatt
ataataatcggcggcggcgctaccggattgggcgccgcagtcgatgcggcttcaagagga
tttaaaactctgttggtagaacaatacgatttttcgaaaggcacgtcgagcagaagcaca
aaacttgttcacgggggagtccggtatctggcgcagggcgatttgtcgctcgttttcgaa
gcgctgcacgaacgaggtcttttgatgcaaaacgctccccaccttgtgaagaatcaacaa
ttcataattccgaattatgaatggtgggaaggaccgttttataatatcggaatgaaagtt
tacgatttaatggcgggtaagcttggactgggaccctcggaaaaaatttcaaaagaagaa
acattaaatgcaattccgaatctcgatcccgaaggattgctcggcggagtaatctattac
gacggtcaattcgacgactcgcgactggcaataaatctggctcaaacggcatacgaaaac
ggagccgttttgctaaactatgtgaaagccgtgggatttacaaaagataaggaaggaatt
cttaacggcgttaatttactggacgtcgaaaccggcaatgctttccatgtgaaaggaaag
acatttataaatgcagcgggaatattcgtgggcgatattaaaaatatggacgagggcgag
aattccaattcggtggcgctgagccgcggcattcatattgtactcgacaaatcgtttttg
cagggtaattcggcgattatgataccgcacactacggacggaagagttttatttgccgtt
ccgtggcacggcaaagttatactcggcacaaccgataccgaagtcgataaacccgaaatc
gaaccgagggcatccgaagaagagatcgattttctgctttcgaattcagcccgatatctt
tcgaaagacccgcaacgctccgatattctgagcgtctttgcaggtttaagaccgctggca
atttccgaaggaaaagccataccgacaaaagatatttcaagaaaacatcagatttccgta
tctccttccggcttgattacaataaccggaggaaagtggacaatctacagaaagatgggc
gaagacttaatcgaccacgcgatattagttggaggactcgaagaacgggaatcggttact
aaaaatctttcaattcacggctatctgaaaaatacgaatcacaacgacccgctctactat
tacggcgcggataaatttcaaatcgaagaaagaattctaaccaaagaaaagcatttgaga
gaaccgattcatccgcatttgccttatataaaggcggaaatcgtttgggcggtgagaaac
gagatggcaataaccgtagaagattttcttgcaagaagaattcgcgcgcttttgctcgac
gctaaagcaagcatcgaaatggcgccggtagcggcggaaattatggctaaagaattaaaa
aaggataacgcctgggcgcaaaatcaaattaatgaatacattaaacttgccagaggatat
ctttccggttatgacgaataa

DBGET integrated database retrieval system