KEGG   Melioribacter roseus: MROS_1452Help
Entry
MROS_1452         CDS       T02176                                 

Definition
(GenBank) MarR family transcriptional regulator
  KO
K15973  MarR family transcriptional regulator, 2-MHQ and catechol-resistance regulon repressor
Organism
mro  Melioribacter roseus
Brite
KEGG Orthology (KO) [BR:mro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mro03000]
    MROS_1452
Transcription factors [BR:mro03000]
 Prokaryotic Type
  Helix-turn-helix
   MarR family
    MROS_1452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MarR HTH_27 MarR_2 HTH_34 TrmB SMC_ScpB CbeA_antitoxin Fe_dep_repress HTH_11 DUF3496
Motif
Other DBs
NCBI-ProteinID: AFN74689
UniProt: I6ZRI9
LinkDB All DBs
Position
1693976..1694401
Genome map
AA seq 141 aa AA seqDB search
MASEKTEAAMKLIEKLNRTADKIRKVQAKYVFEKKLTAPQFAVLEILSRTGPVPLKRISD
EMMVTGANITCVVDNLEKEGFVRRVHSKEDRRVILGELTPEGRKKVEGILPEYMEKLASL
TSGLTESEQKQLIALLDKLTV
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcatcagaaaaaacagaagcagcaatgaagctgattgaaaaactgaaccgtacagcc
gataaaataagaaaggtccaggcaaaatacgtcttcgaaaaaaaattaaccgctccgcag
tttgcggttcttgaaatattgagccgtacgggtccggtgccgttgaaaagaatcagcgac
gaaatgatggtaaccggcgccaatataacctgcgttgtcgacaatcttgaaaaagaagga
ttcgtgcgacgcgttcactcgaaagaagacagaagggttatactgggcgagcttacgccc
gaaggtaggaaaaaagtcgaaggtattttgcccgagtatatggaaaaactggcttccctt
acttcggggcttaccgaaagcgaacaaaagcaattaatcgctcttctggataaattaacg
gtctga

DBGET integrated database retrieval system