KEGG   Melioribacter roseus: MROS_1829Help
Entry
MROS_1829         CDS       T02176                                 

Definition
(GenBank) D-alanine-D-alanine ligase-like protein
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mro  Melioribacter roseus
Pathway
mro00473  D-Alanine metabolism
mro00550  Peptidoglycan biosynthesis
mro01100  Metabolic pathways
mro01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mro00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MROS_1829
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MROS_1829
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    MROS_1829
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mro01011]
    MROS_1829
Enzymes [BR:mro01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MROS_1829
Peptidoglycan biosynthesis and degradation proteins [BR:mro01011]
 Precursor biosynthesis
  Amino acid ligase
   MROS_1829
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C GARS_A ATP-grasp_3 ATP-grasp_4 ATPgrasp_Ter Dala_Dala_lig_N TTL CPSase_L_D2 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AFN75062
UniProt: I6YWW1
LinkDB All DBs
Position
complement(2135457..2136413)
Genome map
AA seq 318 aa AA seqDB search
MNDTYAEWDTIETINAIKEALELFHEVHLIEANEEAFEKFRTLKPDIVFNVSEGFNGISR
EAQIPAMLDLLGIPYTGSDPLTLTTCLDKSRTKEILSYYGIPNARFITVESHDDIINFSL
TFPVIIKPVAEGSSKGIFNSSLVNNIEELQTRLDELLDTYKQPLLIEEFLPGREFTVAIM
GNGKEVEVLPIVEINYASLPENLLPIYSYEAKWIADTPDNPLDIFSCPARLDDVLKSKIE
KTALDTYKILRCRDWARIDIRLDKDSTPNVIEVNPLPGVLPNPEDNSCYPKAARAAGLSY
NEMINKVLYHAAKRHNLI
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgaacgacacatatgctgagtgggatacaatcgaaacaattaacgccatcaaagaagcg
ctcgaactttttcatgaagtacatttaatcgaagctaacgaagaagctttcgaaaaattc
agaaccttgaaaccggacattgtatttaacgtatcggaaggttttaacggcataagccgc
gaagctcaaattcccgcaatgctcgatttgctcggcataccttatacgggttccgacccc
cttactcttactacatgtctcgacaaatccagaacaaaagaaatactttcttattacgga
atacctaacgccaggtttattaccgtcgaatcgcacgacgacattataaacttttcgctc
acgttcccggttatcataaaaccagtagcggaaggttcaagcaaaggaattttcaattcg
tcgctggtcaacaatattgaagaactgcaaacaaggctcgacgaactgctcgatacatac
aaacagcctttattgatagaagaatttttacccgggcgcgaatttactgttgctataatg
ggcaatggaaaagaagtcgaagtgttgccgattgtagaaatcaattacgcttctctgccc
gaaaatcttttaccgatttattcatacgaagcaaaatggattgccgatactcccgacaat
cctctcgatatttttagttgccccgcccggctggacgacgtcctcaaaagcaaaatcgaa
aaaaccgctctcgacacatataaaattttaagatgccgcgactgggcgcgcatcgacatt
cgtctcgataaggacagtacgccgaacgttatagaagtaaatccgctgcccggagttttg
ccgaatcccgaagacaattcgtgttaccccaaagccgcccgagccgcaggattatcgtac
aacgaaatgataaacaaagtgctctaccacgctgctaaaaggcacaacctgatatga

DBGET integrated database retrieval system