KEGG   Melioribacter roseus: MROS_1843Help
Entry
MROS_1843         CDS       T02176                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mro  Melioribacter roseus
Pathway
mro00010  Glycolysis / Gluconeogenesis
mro00051  Fructose and mannose metabolism
mro00562  Inositol phosphate metabolism
mro01100  Metabolic pathways
mro01110  Biosynthesis of secondary metabolites
mro01120  Microbial metabolism in diverse environments
mro01130  Biosynthesis of antibiotics
mro01200  Carbon metabolism
mro01230  Biosynthesis of amino acids
Module
mro_M00002  Glycolysis, core module involving three-carbon compounds
mro_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mro00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MROS_1843
   00051 Fructose and mannose metabolism
    MROS_1843
   00562 Inositol phosphate metabolism
    MROS_1843
Enzymes [BR:mro01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MROS_1843
Exosome [BR:mro04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MROS_1843
  Exosomal proteins of bladder cancer cells
   MROS_1843
  Exosomal proteins of melanoma cells
   MROS_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFN75076
UniProt: I7A5B4
LinkDB All DBs
Position
complement(2155513..2156271)
Genome map
AA seq 252 aa AA seqDB search
MRKKIVAGNWKMNNDLNSSVALISEIKNLLASKSLNAEVIICPPFTSLDAANSLIKDTQI
KLGAQNMYYEKSGAFTGEISPLMLKSVGCQYVILGHSERRTIFGESNQLINKKIKAAVEN
QLNPIFCIGETLEERESGVTFKIIETQMREGLEGLTAEELANLIIAYEPVWAIGTGKTAT
PEQAEEVHAFIRKLIGELYSTEFAEKLIIQYGGSVKPENAAELMSQPDIDGALVGGACLK
ADSFVKIIESAQ
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaaaaattgttgctggtaactggaagatgaataacgacctaaattcttcagtt
gctcttatatcggaaatcaaaaacttattggcgtcgaaatcattaaatgccgaggttata
atttgccctcctttcacttctctcgacgccgcgaacagtttaatcaaagacacccaaatt
aaattgggcgctcaaaatatgtattatgaaaaaagcggagcttttaccggcgaaatttcg
ccgcttatgttaaaaagcgtcggatgccaatatgttattttaggccactccgaaagaaga
actatctttggcgagtcgaatcaattaatcaacaagaagattaaagcagccgtcgaaaac
caattgaatcctattttttgcatcggcgaaacattggaagaacgcgaaagcggagttaca
tttaaaattatcgaaactcagatgcgagaaggactcgaaggtttgacggcggaagaattg
gcaaatcttataattgcatacgaacccgtatgggctataggaacaggaaaaaccgctact
ccggaacaagccgaagaagttcacgcttttatcagaaagctgatcggcgagctctattca
actgaattcgcagaaaaacttattattcaatacggcggcagcgtaaaacccgaaaacgcc
gcagaattgatgtcccagcccgatatcgacggagctcttgtgggaggagcctgccttaaa
gcagactcgttcgtaaaaattatcgaatccgcacaataa

DBGET integrated database retrieval system