KEGG   Melioribacter roseus: MROS_2081Help
Entry
MROS_2081         CDS       T02176                                 

Definition
(GenBank) Glycosyl hydrolases family 2, immunoglobulin-like beta-sandwich domain protein
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
mro  Melioribacter roseus
Pathway
mro00052  Galactose metabolism
mro00511  Other glycan degradation
mro00600  Sphingolipid metabolism
mro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    MROS_2081
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    MROS_2081
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    MROS_2081
Enzymes [BR:mro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     MROS_2081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro2_C5 DUF4982 Glyco_hydro_2_C Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Big_1 Invasin_D3
Motif
Other DBs
NCBI-ProteinID: AFN75311
UniProt: I7A5Z2
LinkDB All DBs
Position
2430158..2432899
Genome map
AA seq 913 aa AA seqDB search
MRISKFFISLILFISLLCNDFVYTDGKATNEKNVREKILLNKEWKFFKYNNAADADNLIY
DARPAVTDYKDDKPADAMPTEAEKVDHRKDVLKPWILPTGNEFLKDKSKHYKRPESNPGK
DFPFVQLNYDDSLWEQVNLPHDWAIKGPFYEGENAEVGGGMGRLPSHGVAWYRKKVFIPG
HDSTKQIYLDVDGAMSYAMVWINGYLAGGWPYGYNSFRIDLTPYINFGKENIIAIRLDNP
PKSSRWYPGGGIYRNVWLVKTNRVHVAQWGAFITTDSVSKSSAGVNIKTKVDNKSNKKVI
ADIVSEIYLLDKSGHKIDSLIAKDYLSSIEIEAGNNRIVNQTIKINNPKLWGIPPNQEPN
LYIAETKILMEGKLVDYYTTRFGIRELKFEPDKGIFLNGELIEVKGVNLHHDLGALGAAF
NVRAAERQLELLRDMGCNAIRFAHNPPAPEFLELTDKMGFLVVDEIFDVWERKKTPLDFH
LIFHEWHEQDLRAFIRRDRNHPSVIIWSFGNEVGEQYTDMEGAELAKHLYDIVKDEDSTR
PATAAMNYAKPHMPFPQVMDLISLNYQGEGIRNAPAYAHLKGIKTEPLYDDFHKKFPDKV
ILSSENAAAVSSRGTYLFPVYEGISSPIRDTIGGDPVRKYVSAYELYTADFGSSADKVFG
SLDRHPYVAGGFVWSGWDYLGEPTPYYEARSSYFGVIDLTGFKKDRFYLYQSYWRPDYPM
AHILPHWNWPERAGKITPVHVFTSGDEAELFLNGKSLGKKKKGDYEYRLRWDDVIYEPGE
LKVIAYKNGKIWARDSVKTTLDPARIELIPDRSVIKSDGSDLSFVTVRIKDENGLIVPNA
SNMIKFEIEGPGEIVATDNGDPTCMIPFPSKNRNAFNGLALVIVRSIEGSKGKIILRASS
EGLLGDSVLINAE
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgagaataagtaaattttttatttcattaatattatttatttcattgttatgtaatgac
ttcgtctataccgacggaaaagcgacaaatgaaaaaaacgtaagagaaaaaattttactg
aacaaagaatggaaattttttaaatataataatgcggcagatgccgataatttgatttac
gatgcgagacctgctgtaactgattataaagatgacaaacctgcggatgctatgccgacc
gaagctgaaaaagttgatcatcggaaagatgtccttaagccatggatactgcccactggc
aacgagtttcttaaagataaatctaaacattataaaagaccggagagcaatcccggcaaa
gattttccgttcgttcaattgaattacgacgacagtctttgggagcaggtaaatttaccc
cacgattgggcgattaaagggccgttttacgagggagaaaatgcagaagtaggcggcggt
atgggacgattgccgagtcatggcgtagcatggtacagaaaaaaagtttttataccaggt
catgattcgactaaacaaatttaccttgatgtggacggcgcaatgtcgtatgctatggtg
tggattaacggataccttgcaggcggatggccctacggttataattcattcagaattgat
cttactccgtatataaatttcggtaaagaaaatattatagcaatacgtctggataatcct
cccaaatcttcgcgttggtaccccggaggaggtatttacagaaatgtgtggctggtaaaa
acaaatcgcgttcatgtggcgcaatggggcgcgtttattaccaccgatagcgtgagtaaa
tcttccgcaggtgtaaatatcaaaacgaaagtagataataaatctaataaaaaagttata
gccgatattgttagtgaaatttatcttcttgacaaatcgggacataaaatcgatagtctt
attgcaaaagactatctatcgagcatagagattgaagcgggaaacaatcgaattgttaat
caaacaattaaaataaacaatccgaaactttggggaataccgcctaatcaggagccgaat
ctttatattgccgaaacaaaaatattaatggaagggaagttagttgattattacactact
cgatttggaataagagaattaaaattcgagcccgataaaggtatttttcttaacggcgaa
ttgattgaagttaaaggagtaaatctacatcacgatctcggagcattaggagctgcgttt
aacgtaagagccgccgaacgtcaacttgaactgttaagagatatggggtgtaatgcaata
cgatttgctcacaatccgcctgcgccggaatttcttgaattaacagacaagatgggcttc
ctggtagtggatgaaattttcgatgtatgggaacgcaagaaaacgccgctcgattttcat
cttatttttcacgaatggcacgagcaggatttaagagctttcattcgacgggacagaaat
catccgtctgtcattatctggagtttcggtaatgaagtcggagagcaatatactgatatg
gaaggcgccgaattggcaaaacatctttatgatattgtcaaagatgaagattccacaaga
ccagctacggcggcaatgaattacgccaaaccgcatatgccctttcctcaagtaatggac
cttatcagtctgaattatcagggcgaaggcatcaggaatgcgcctgcgtatgcgcactta
aaagggattaaaaccgaaccgttatacgacgacttccataaaaaattccccgataaagta
atcctgagcagcgaaaacgcggcggcggtgagcagcagaggcacgtatttgttccccgtt
tacgagggaataagctcgcctatcagagatacgataggaggcgacccggtaagaaaatac
gtaagcgcttatgaattatatacggctgatttcggctcgtctgccgataaagtttttgga
tccctcgacaggcatccgtacgtagcgggcggattcgtctggagcggatgggattatctc
ggcgaacccacgccttattacgaagcgcgcagttcttacttcggagttatcgaccttacc
ggctttaaaaaagacaggttctatttatatcagtcatattggcgtcccgattatccgatg
gctcatattctgcctcactggaactggccggagagagcgggcaaaattacgcctgtccat
gtttttacatcaggcgacgaagccgagttatttctaaacggaaagtctttgggcaaaaag
aaaaagggtgattacgaatatcgcttacgctgggacgacgttatttacgaacctggcgaa
ttaaaagttatcgcttataagaacggcaaaatatgggctcgcgatagtgtgaaaaccacg
ctcgacccggctcggatcgagttaatccccgatagaagcgttatcaagtcggacggttcg
gatctttcttttgttacggttagaattaaagatgaaaacggtttgattgtcccgaacgcc
tctaatatgattaaatttgaaatagagggacccggcgaaatagtcgctactgacaatggc
gatccgacttgtatgattccgttcccgtcgaaaaaccgtaatgcttttaacggactggca
ttggtaatcgtccgctctattgagggctctaaaggtaaaattatcttaagagcttcttcc
gaaggattactaggggatagcgttttgataaatgccgaataa

DBGET integrated database retrieval system