KEGG   Melioribacter roseus: MROS_2469Help
Entry
MROS_2469         CDS       T02176                                 

Definition
(GenBank) pterin-4-alpha-carbinolamine dehydratase
  KO
K01724  4a-hydroxytetrahydrobiopterin dehydratase [EC:4.2.1.96]
Organism
mro  Melioribacter roseus
Pathway
mro00790  Folate biosynthesis
mro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MROS_2469
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mro04147]
    MROS_2469
Enzymes [BR:mro01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.96  4a-hydroxytetrahydrobiopterin dehydratase
     MROS_2469
Exosome [BR:mro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MROS_2469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_4a
Motif
Other DBs
NCBI-ProteinID: AFN75699
UniProt: I6ZUL0
LinkDB All DBs
Position
2890978..2891268
Genome map
AA seq 96 aa AA seqDB search
MNKLDEKSISERLPSLKGWSFDNNKLIRNFKLDSFSDAVAFVVKIAIESEKIDHHPDIRL
FGWNNVEVTLQTHNVNGITENDFKLANSINILYSNG
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atgaataaactcgacgagaaatcgatatccgaaagactgccctcattaaaagggtggtct
ttcgacaataataaattgatacgcaatttcaaactcgattctttctcggacgcggttgcg
tttgtcgtcaagatcgccatcgaatccgaaaaaatcgatcatcatcccgacatcagatta
ttcggatggaataatgtggaagtaactctacagactcacaacgttaacggtattaccgaa
aatgactttaaactcgctaattcaataaacattttatactctaatggataa

DBGET integrated database retrieval system