KEGG   Melioribacter roseus: MROS_2692Help
Entry
MROS_2692         CDS       T02176                                 

Definition
(GenBank) carbohydrate phosphorylase family protein
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
mro  Melioribacter roseus
Pathway
mro00500  Starch and sucrose metabolism
mro01100  Metabolic pathways
mro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MROS_2692
Enzymes [BR:mro01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     MROS_2692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase
Motif
Other DBs
NCBI-ProteinID: AFN75922
UniProt: I6YZE7
LinkDB All DBs
Position
complement(3130109..3132670)
Genome map
AA seq 853 aa AA seqDB search
MVNYIGRFNVIPSLPKKLEPLREIVYNLFWTWNYDAIDLLRRLDPQLWEETYHNPVLMLG
KISQKRLNDVAADDSFLAHMDRVYTQLKVYKEEKTWYQKNYNYGNENVIAYFSAEYGLTE
SLQIYSGGLGVLSGDHLKSSSDLGIPLVAVGLCYKEGYFQQYLTNDGWQQERYEITDFYN
QPMTLITNKDNTPLKIELDFPGRKVYFQIWKIEIGRIPLYLLDTNVPENREEDRKITRTL
YGGNIETRIQQEIVLGIGGIRALHAMELRPLVCHMNEGHSAFLSLERIRLLIKLYGLSFN
EAKDINFHSNIFTTHTPVPAGIDIFPNDLMEKYFGAYYRNELQIDDKTFYKLGTIVKDKP
PTNFNMAHLAMNMAGFVNGVSKLHGQVSKKMWQSGFPDIPFDEIPIEHVTNGVHIHSHLS
NDMYELLYRYLGEKFNRDPSDEEVWKRIDEIPDEELWRTHERRRERLVAFARNRLKKQIM
QRGGSASEINAAKEVLDAQALTIGFARRFATYKRANLIFRDIERLESILCNPDYPVQLIF
AGKAHPKDEEGKKLIQEVIAMTKEPSLRKKIVFIENYDMNVARYMVEGCDVWLNNPRRPL
EASGTSGMKVIANGGLNLSVLDGWWDEAYNHEVGWKIGNGEEYENLDYQDEVESRLIYEM
IEKEIIPLFYNRGEDKLPRGWIAMMKNSMRALGPFFNTHRMVREYSERFYFKAYEKRLLL
MNNKWKKAKEFSAWKQKVYQNWSNVKFISIAEELKGVELKVGNKYPITAEVELGDLTPKD
IDVQIYYGKIDNGEKDKNFVTMTYVPKKSKDNRYTYRGEIECVNTGQFGFTLRILPKHEL
LINQFELGLIRWA
NT seq 2562 nt NT seq  +upstreamnt  +downstreamnt
atggtcaactatattggcagatttaatgtaataccttcgttgccgaagaaactcgaaccg
ctcagggaaattgtttacaatcttttctggacatggaattacgacgcaatcgatttgttg
agaagactcgacccgcaattgtgggaagagacgtatcataatcctgtattgatgctcgga
aaaataagtcaaaaaagattgaacgacgttgcggccgacgacagctttctggcgcatatg
gacagagtctatactcaactcaaagtttataaagaagaaaagacttggtatcaaaaaaat
tataattacggtaatgaaaatgtaattgcatatttttccgccgagtacggattaacagaa
tctttgcaaatttattcgggcggcctcggcgtgctctccggagaccatctcaagtcttcc
agcgacctcggaattccgcttgtagcagtaggactttgctacaaggaaggatatttccag
cagtaccttacgaacgacggctggcagcaggagaggtacgagattaccgatttctacaat
caaccgatgacgcttattactaataaggataatacgccgctcaaaatagaactcgacttc
cccggcagaaaagtttatttccagatctggaaaatcgaaatcggaagaataccgctatat
cttctcgatacgaatgtgcccgagaacagggaggaagacagaaagattacgcgcactctc
tacggcggaaatatcgaaacgcgtatacagcaggaaatcgtattgggtatcggaggcatc
cgcgctctacatgccatggaactgcgcccgctggtttgccatatgaacgaaggacattcg
gcttttctgtcgctcgaaagaattcgacttttaataaaattatacggactatcgttcaac
gaagctaaagacataaatttccattccaatatttttaccacgcatactccggtgcccgcc
ggaatcgacattttcccgaatgatttgatggaaaaatatttcggcgcttattacagaaac
gaactacagatcgacgataaaaccttttacaaactcggaacgattgttaaagacaaaccg
ccgacaaatttcaatatggcgcatctggcaatgaatatggcgggattcgtaaacggcgta
agtaaattacacggacaggtatccaaaaaaatgtggcagagcggattcccggatattccg
ttcgacgaaattccgattgaacacgttacaaacggagttcatattcattcgcatctgtcg
aacgatatgtacgaattgctctaccgttatctgggagaaaaattcaaccgcgacccttcc
gatgaagaagtatggaaaagaatcgacgaaattcctgacgaagaattgtggcgtacgcac
gaaagacggcgcgaaagactcgtcgcatttgcgcgcaaccgtttgaaaaaacagattatg
caacgcggcggctcggcttcggaaataaacgccgcaaaggaagtgctcgacgctcaggca
ttgactatcggatttgcccgcaggtttgccacatataaaagagccaatttgattttcagg
gatatagaacgcctcgaaagtattttatgcaatcccgattatcccgttcagttgatcttt
gcaggcaaagctcaccctaaagacgaggaaggtaaaaaactgattcaggaagtgatagca
atgacaaaagaaccgtcattgcgcaagaagatagttttcatcgaaaactacgatatgaat
gtcgcgcgttatatggttgaaggatgcgacgtctggctgaataatccgcgcagacctctc
gaagccagcggcacttccggcatgaaagtaattgcaaacggcggattgaatctgagcgtg
ctcgacggctggtgggacgaagcttataatcacgaagtcggatggaaaataggcaacggc
gaagaatatgaaaatctcgactaccaggacgaagtggaatcgcgactaatctatgaaatg
atcgaaaaggaaattattcctcttttctataacagaggcgaagacaaactcccccgcggc
tggattgcaatgatgaaaaattcaatgcgcgctctcggaccgtttttcaatacgcatcgc
atggttcgcgaatattccgaacgcttctatttcaaagcctacgaaaaacgcctattgctg
atgaataataaatggaaaaaagcaaaagaattttccgcctggaaacaaaaagtatatcaa
aactggagcaatgttaaattcataagcattgcagaagaacttaaaggcgttgaattgaaa
gtaggcaataaatacccgataacggcggaagtggaactcggagaccttacgcctaaagat
atcgacgttcagatttattacggtaaaatagataacggagaaaaagataaaaatttcgtg
acgatgacttacgttccgaaaaaatcgaaagacaacagatatacatatcgcggagaaatt
gaatgcgtcaataccggacagttcggttttacgttgcgtattcttccgaaacacgaattg
ctgatcaaccagttcgaacttggtttaatcagatgggcttag

DBGET integrated database retrieval system